2TMA


Conserved Protein Domain Family
Tropomyosin_1

?
pfam12718: Tropomyosin_1 
Tropomyosin like
This family is a set of eukaryotic tropomyosins. Within the yeast Tpm1 and Tpm2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpm1p spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tpm3 members.
Statistics
?
PSSM-Id: 403808
View PSSM: pfam12718
Aligned: 25 rows
Threshold Bit Score: 88.9008
Threshold Setting Gi: 530774822
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2TMA_A                7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEadva 86 
EAW11835             16 RMSALRLEADEAQNKVEELKSKVKTLEQENLAKEQEITSLNHRNQLLEGEVEKLETTLKEAKESANQSAQHDTQNE---- 91  Aspergil...
CAP95349              7 RMVSLRAEADEAHELVDELKAKVKTLEQENLSKEQEITSLNHRNQLLEEEVEKAEAALKEAKDAASQSLQHDTQNE---- 82  Penicill...
WGS:AATM:SJAG_04887   7 KLNSIRAEAEEALARAEAAEESLKEKEHELARKDQELASLHKKNEDLEEQVDQLEQELKDVKEQAESESNQQSLID---- 82  Schizosa...
EDP45051              7 KLNSLRAEADAALERAEVAEARNKELEQDNLSKEQEISSLQHKLSVLESDLENAEAKLSEAKVGKEEGESHKSNVD---- 82  Malassez...
XP_001874619         10 KLNSLRTEADNAVLRAEEAEAKNKKYEQLLLEKEQEITSLQHKLSQLDAELEKAEEKVAEYKTANVDGEQTKMTSE---- 85  Laccaria...
Q5KF76               10 ILGQ-KIEAAEA--RAEAAESENKKLNQTLLERDQELASLQHKLQLAEEELEASESKVKELKAASDEGETHRTTGE---- 82  Cryptoco...
XP_006511103          7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEadva 86  house mouse
Q17H75                7 KMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKALQNAEseva 86  yellow f...
EEN46834              7 KMLMLKNDKENALDRAEQAEQAMKDAQEKNVKLEDEINDLNKKIRMVEDELDKAQESLKDATEQLEAATKKAADAEaeva 86  Florida ...
2TMA_A               87 SLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
EAW11835             92 ALQRRVQLLEEEAEEADRNLRETNEKLRQTDVKAGHYERKVQALEASRDQWESKYEEMAKKYAELQ 157 Aspergillus clavatus N...
CAP95349             83 ALQRRVQLLEEEAEENDKTLRETNEKLRQTDIKAGHYERKVQALEDQHAKLEQRYEDAIKEHSAVK 148 Penicillium rubens Wis...
WGS:AATM:SJAG_04887  83 SLNRKIESLEEELENSDKSLRETTEKLRQIDINTEHTERKIQALEHERDDLEVRLEDTTDKYNKVK 148 Schizosaccharomyces ja...
EDP45051             83 ILQRRIDMLEEQLDQSERSLKETTEQLRHTDVRAEQLERQIQGAEQERDQWEHKYEEAQERYQASK 148 Malassezia globosa CBS...
XP_001874619         86 GLQRKVQLLEEELDVAEKNVKETVERLRQVDVKAEHFERQVQRLEQERDLWEKKYEESEAKYKKSQ 151 Laccaria bicolor S238N...
Q5KF76               83 NLARKVQLLEEELDKAEKDLKETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSK 148 Cryptococcus neoformans
XP_006511103         87 SLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152 house mouse
Q17H75               87 ALNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEAR 152 yellow fever mosquito
EEN46834             87 SLNRRIQLVEEELDRAQERLNSTVEKLTDSEKAADESERARKVLENRGAADEDRMELLDMQLREAK 152 Florida lancelet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap