Conserved Protein Domain Family
Kinetocho_Slk19

?
pfam12709: Kinetocho_Slk19 
Central kinetochore-associated
This is a family of proteins integrally involved in the central kinetochore. Slk19 is a yeast member and it may play an important role in the timing of nuclear migration. It may also participate, directly or indirectly, in the maintenance of centromeric tensile strength during mitotic stagnation, for instance during activation of checkpoint controls, when cells need to preserve nuclear integrity until cell cycle progression can be resumed.
Statistics
?
PSSM-Id: 403801
View PSSM: pfam12709
Aligned: 19 rows
Threshold Bit Score: 69.6212
Threshold Setting Gi: 238851378
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003958378 654 DITQRLKNLADDLYVKYSSKHEQKVKLLKKSYESKYQSEIERLSLENKGFNQEIEQLNKQIENERREKQELLKILET 730  Kazachstania afri...
CCK68021     677 EFNKKLKKLSEDLYVQYSSKHEQKVKLLKQTYENKYKGEIEKLKNENNGLTQEMEQINSKLTLERAEKQELLRVLDQ 753  Kazachstania naga...
Q6FPY1       739 EKNKQLQQLSDDLYVQYSSKHEQKVKMLKKNYEATYKKNLEELKMQNKSYIQEIKQLTSQLDYERKEKQELLKLLEQ 815  [Candida] glabrata
EEQ40842     175 KTDERIQDVAEQLYHQYSKKHELKVNQLKEKYDAKIEDSHRELEQK----RREIETLDSQLKTEMKEKNYLLSVLEK 247  Clavispora lusita...
EDK39950     118 RTTKKIDEVAESLYTQYSKKHETKVGMMRTSF----NKKLDQLQGENNQQKLDIESLRKQLDAAVAEKDSLLELLDD 190  Meyerozyma guilli...
Q6BHF8       807 KTNARIQEVAEQLYFEYSKKHELKVNQVRASF----KKQIDNLHFEKKSQARDIDSLQKKLEIVNMEKNQLLRLIDe 879  Debaryomyces hans...
XP_011277162 837 ETEKRLQQLAEDLYIQYSKKHEQKVQVLKKNYENKWQQKLSRTETDNERLRGEIEGLKAQLEAERAEKAEVLKLWDQ 913  Wickerhamomyces c...
XP_013934091 670 NLEQQLEKLAQDLYLQYSAKHEQKVAILKKGYEMKWMNKLKKLSKENEQLRSEVESFKRRLEVENNEKKQLVKLWEE 746  Ogataea parapolym...
CAY68890     662 QAEQKLQQLAQDLYVQYSAKHEQKVSVLKKGYETKWSSKLNKVTEEKNTLKQEVQKLKQKLTSEREEKTRLVKLWDE 738  Komagataella phaf...
Q6CLS5       552 ETNKKLQLLAEDLYIQYSSKHEQKVKMLKKGYEAKYQDLLDKLTVENNALHDEVDQLQKAVEIERAEKQELIKSLDN 628  Kluyveromyces lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap