3IHT


Conserved Protein Domain Family
Methyltransf_17

?
pfam12692: Methyltransf_17 
Click on image for an interactive view with Cn3D
S-adenosyl-L-methionine methyltransferase
This domain is found in bacterial proteins. The structure of the proteins in this family suggest that they function as a methyltransferase.
Statistics
?
PSSM-Id: 403786
View PSSM: pfam12692
Aligned: 9 rows
Threshold Bit Score: 260.04
Threshold Setting Gi: 256599917
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IHT_B         13 QSRLDLFIDRXVSQRACLEHAIAQTAGLS-GPVYELGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGD 91  Ruegeria pomer...
vbi:Arad_9520   1 MSRLDSFIRRLTAQRDILNGIADEVKTLD-GPVLELGLGNGRTFDHLRELFSDRRIVAFDRAANAYGPSMPEAGNLVLGE 79  Agrobacterium ...
Q2K041          1 MSRLDSFIRRLTAQRDILNAITALVEDIE-GPVLEFGLGNGRTYDHLREKFPGRRIIAFDWEVRSYSASTPEPQDMVTGN 79  Rhizobium etli...
Q16B83         22 MSRLDLFIARMVSQRACLNHAAQLTADIS-GPVFELGLGNGRTYHHMCEIMPEQDIYVFERAIASHPDSTPPDDRVLLGD 100 Roseobacter de...
Q16B98          1 MSRLDSMRRRLSAQIDGLNWAAEQVQGID-GDVLELGLGNGRTYDHLREVLPERRIWVIDRVLQPHPSCVPPAENFLQGE 79  Roseobacter de...
Q5LVZ5         11 MSRLDSMLRRLTAQRDGLNWAALQISGIP-GEVLDMGLGNGRTYDHLREILPGRRIRVMDRVLQCHPSCTPPEADFLMGE 89  Ruegeria pomeroyi
Q1GL05          1 MSRLDSMLRRLTAQRDGLNWAAQEISLLT-GDVLDLGLGNGRTYDHLREVMPERRIWVIDRVLQCHPSCVPPEENFLQGE 79  Ruegeria sp. T...
vbi:Avi_3940    1 MSRLDSFINRMSAQRDLLNHIRDAYPLPE-GPVLEIGLGNGRTFSHLRENFTGRRIIAFDRQLGAHKSSIPQEGDLILGE 79  Agrobacterium ...
Q8U536         19 MSRLDSFIRRLSAQRDILNHVEADLDLPDqGALMEIGLGNGRTFNHLRELFPNRRIIAFDRAMGAHASSVPAVEDLVIGE 98  Agrobacterium ...
3IHT_B         92 IRETLPAtleRFGATASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLXVSSDRXYFEGLEELPLPPGAVVGRCFIY 171 Ruegeria pomer...
vbi:Arad_9520  80 IKDTARD---FIGIGASLAHADIGTGYEEKDAVTLTWLPEIMVGVLAPRGIAVSGLSLDHPDLEPLPLPAGVKAGRYFIY 156 Agrobacterium ...
Q2K041         80 IRDSGQA---FLGIGAALAHADIGTGHDEIDAVTLTWLPQLMAGVLAPNGIAVSGLPLEHPDLTALPLPEGIKEGRYFLY 156 Rhizobium etli...
Q16B83        101 VFETLPLaltRFGATARLIHADLGGHNAQKNDEFARRVSPLIEPLLADGGLMVSSDRMYFETLTQIALPQDAIEGRCFIY 180 Roseobacter de...
Q16B98         80 ADDMLATl-aKTDAKCALAHYDFGFGVKDLDVAEGARLSPLIAALMVPGGLVVSQQPLV--GLTQISGPDTIDPERYLFY 156 Roseobacter de...
Q5LVZ5         90 AEPMLERl-aAEGAPIVLAHYDFGMGIKADDVAEAARLSPLIARVMVPGGLIISGQPLV--GFTPVAAPDSIPPERYLFY 166 Ruegeria pomeroyi
Q1GL05         80 AAPMLDRl-aEGGHKLALAHYDLGFGIKEKDVAEAAKLSPVIARVMVPGGVIVSGQPLV--GFKEIDGPEGIPEGRYMFY 156 Ruegeria sp. T...
vbi:Avi_3940   80 IDQTGQD---FTGCGAAFVHADIGTGYPDRDAVTLTWLPDMVAGMLRPGGYALSGLPLDHEALEPLPVLDHIEKDRYFFY 156 Agrobacterium ...
Q8U536         99 ISQTAPA---FIGTDAAMVHADIGTGYPEKDAVTLTWLPDLAAGMLAKGGIAISGLPLDHAMLKPLPVPESVPTDRYFLY 175 Agrobacterium ...
3IHT_B        172 RR 173 Ruegeria pomeroyi DSS-3
vbi:Arad_9520 157 RR 158 Agrobacterium radiobacter K84
Q2K041        157 RR 158 Rhizobium etli CFN 42
Q16B83        181 RR 182 Roseobacter denitrificans OCh 114
Q16B98        157 RA 158 Roseobacter denitrificans OCh 114
Q5LVZ5        167 RA 168 Ruegeria pomeroyi
Q1GL05        157 RV 158 Ruegeria sp. TM1040
vbi:Avi_3940  157 RR 158 Agrobacterium vitis S4
Q8U536        176 RK 177 Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap