3KLB,3KLB


Conserved Protein Domain Family
Flavodoxin_4

?
pfam12682: Flavodoxin_4 
Click on image for an interactive view with Cn3D
Flavodoxin
This is a family of flavodoxins. Flavodoxins are electron transfer proteins that carry a molecule of non-covalently bound FMN.
Statistics
?
PSSM-Id: 403777
View PSSM: pfam12682
Aligned: 2 rows
Threshold Bit Score: 334.741
Threshold Setting Gi: 284794020
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KLB_A   6 KILVAYFSCSGVTKAVAEKLAAITGADLYEIKPEVPYTEADLDWNDKKSRSSVEXRDALSRPAISGTLFHPEKYEVLFVG 85  Bacteroides fragilis ...
3KLB_A   6 KILVAYFSCSGVTKAVAEKLAAITGADLYEIKPEVPYTEADLDWNDKKSRSSVEXRDALSRPAISGTLFHPEKYEVLFVG 85  Bacteroides fragilis ...
3KLB_A  86 FPVWWYIAPTIINTFLESYDFAGKIVVPFATSGGSGIGNCEKNLHKAYPDIVWKDGKLLNGQITRDLVTEWFEKI 160 Bacteroides fragilis NCTC ...
3KLB_A  86 FPVWWYIAPTIINTFLESYDFAGKIVVPFATSGGSGIGNCEKNLHKAYPDIVWKDGKLLNGQITRDLVTEWFEKI 160 Bacteroides fragilis NCTC ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap