Conserved Protein Domain Family
DUF3791

?
pfam12668: DUF3791 
Protein of unknown function (DUF3791)
This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 71 and 125 amino acids in length.
Statistics
?
PSSM-Id: 403764
View PSSM: pfam12668
Aligned: 68 rows
Threshold Bit Score: 49.0331
Threshold Setting Gi: 357560572
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDA90536     16 EFAIFCIENVAQRLGESGEKVFFDLTvASNILyDYIVPCYETLHTQDKEYIVDDILGVMKER 77  Firmicutes bacterium CAG:238
CDA15010     16 GFTVACVNEFANRHKLSSKEAFRYLF-QFKGI-AFIKENYDVEHTLDFDTILDDLEILCKKN 75  Firmicutes bacterium CAG:212
WP_013701813 10 RYTVACVNEFARAKSLSKTQAFLYLL-EHKAL-DFLTEFYDVEHTLSFDDAVSDMTQICQKN 69  Treponema succinifaciens
CDA91639      9 NYTVACVSEFANKHEMTQQAAFQFLY-EHKAI-AFLKDCYEIEHTLSFDDAVEDMERICANN 68  Firmicutes bacterium CAG:238
WP_022162977 15 EYLLSLISHFAERNGLNKMQAYRYIK-RFGGI-KLVDEHYNIMHTLSFDEALDSLTHYLNRQ 74  Bacteroides ndongoniae
AEB13521     11 EYTVALVSDFAKKYSLSNTQAFNYLD-RFNAI-TLLEQHYNIAHTLAYSEMVDTLASYCKDH 70  Treponema succinifaciens DSM 2489
CDD83785     10 QYTVALVSEFSAHFGISQQQALNYLV-RFKGL-AHLEEFYNILHTHSFNDSIDALAKVCRNN 69  Bacteroides sp. CAG:462
CCZ13487      7 EYIIMLIKLFARHFGLSFQQAYRYVS-IHQGI-EYAEQHYNVLHTLSFEDQVEGLATYCHKK 66  Prevotella sp. CAG:1092
CCZ33898      9 GFTVACVNEFARQHNIGIQESFRYLF-RFKGI-DFIKENYEVEHTLDFETIVEDLGILCRKN 68  Firmicutes bacterium CAG:646
CDE36534      9 NFTVACVDEFAQKNNLSVKEAFQYLF-QFKGI-EFIKENYEAEHTLSFDTVLEDLGILCRRN 68  Eubacterium sp. CAG:38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap