Conserved Protein Domain Family
DUF3785

?
pfam12653: DUF3785 
Protein of unknown function (DUF3785)
This family of proteins is functionally uncharacterized.This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. These proteins share two CXXC motifs suggesting these are zinc binding proteins. This protein is found in clostridia in an operon with three signalling proteins, suggesting this protein may be a DNA-binding transcription regulator downstream of an as yet unknown signalling pathway (Bateman A pers obs).
Statistics
?
PSSM-Id: 403753
View PSSM: pfam12653
Aligned: 6 rows
Threshold Bit Score: 177.636
Threshold Setting Gi: 81767081
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q181X2                 4 YKFIYDDKEYLLKEENCSALINDEENPVQGVSISKIIDILNEAEEVDFDVEYYQEACpLClEGVKEKKKFFPFLEYHFYI 83  Clostri...
goetting:Cspa_c55500   3 YKFAYDNKDYLLTNENCEGLFFEDDNEIVGLSLDLILNALNEGEDVAFSNEYYSGKC-SC-NTQDEVNKSYRYLEYHFYI 80  Clostri...
EHJ02325               3 YKFSHNGKEYVLTKENCDGIFFDDEATVSGLSMDIILDALNEGEEVNFSNEYYMGKC-SC-NSQEEVNKSYRYLEYHFFI 80  Clostri...
OAV41657               3 YTFIHENKEYVLSNDNCEGLFFEDENEITGLSFDIILEALNNSNDVNFSNEYYVGKC-QC-GEQEKINKSYRYLEYHFYI 80  Clostri...
Q8XK35                 2 FSFTFDEKEYTLSEDKLLYFFNED---VEGFDIDKLFEILNSSEGVSFGKAYYDGPCeECkFGLEEKKKSFPFLEFNMFI 78  Clostri...
WP_007287743           2 LKFVYDEKEYVLEKDKNVCFLNDEEKPVEGISLDDILNMIDNLEEIDFDTQYYKEACvEClDGVKEKQKFFAFLEYHFYI 81  Intesti...
Q181X2                84 FSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV 139 Clostridioides difficile 630
goetting:Cspa_c55500  81 YTKNKEYVINTIENEYKATSFNKLFNAGKIDDSYIVIVTACPNCGVYSISVEQCTV 136 Clostridium saccharoperbutylace...
EHJ02325              81 YTKNNQYVINTIGNEYKHTSFNQLFGFGKVDDSYIVSVTVCPNCGEYSISVEQCTV 136 Clostridium sp. DL-VIII
OAV41657              81 YTKNNTYVINTISKEYENTSFNKLFNLGKVDDSYIINVTVCPICGLYAIEVSQCTV 136 Clostridium saccharobutylicum D...
Q8XK35                79 YAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV 134 Clostridium perfringens
WP_007287743          82 YTKDQKFIISDIQKEYEGQSFNKLLRANKVDDSYIVSLIICKNCGDTLIQIENCVV 137 Intestinibacter bartlettii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap