3ERC


Conserved Protein Domain Family
Pox_polyA_pol_N

?
pfam12630: Pox_polyA_pol_N 
Click on image for an interactive view with Cn3D
Poxvirus poly(A) polymerase N-terminal domain
This domain is found at the N-terminus of the pox virus Poly(A) polymerase protein. According to SCOP this domain contains a helix-hairpin-helix motif.
Statistics
?
PSSM-Id: 403734
View PSSM: pfam12630
Aligned: 9 rows
Threshold Bit Score: 128.638
Threshold Setting Gi: 18203088
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ERC_C  13 ITLK---IIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTY 89  Vaccinia virus WR
Q9Q8R9   1 MNARiaeLLHNYLGRPPSLSEYHMLKLQHRNIQKIIAFNKDIFISLIKKNKKKFFSDIDLTSSEIKTSVLSYFSKQRDTY 80  Myxoma virus (strain ...
Q98199   1 MNGAqfeLLREYLGRPPTLNQYFIFKPQARAIQRIMRFDTDVFFALIKKNKKRFFARIGGSASEINARVLSYFVKQRATT 80  Molluscum contagiosum...
Q070J7   1 MNNRe--LINRYLGKTADQPIYYALFHKVGKIKQILNFDLNVFLKLLLKNRDRFLRENKQPTAEIKRRLTHYFTKQHRVR 78  Nile crocodilepox vir...
Q9J5B8   3 rsRQvyyIINEYLGRHPSSTEYQVLKHQVEKISKINNFNKETFFFLLKKNKNKFFKDLELSDDLLKKRIDEYFSKQKHAK 82  Fowlpox virus strain ...
Q6TVV2   1 ---mappVIEEYLGSRPSMERCVLLRAQRRNMSRVLNFDRKLFLSLVVKSRRRFFKKLGGSEKEIAARIEEYFSRQRRLE 77  Orf virus
Q6TUY0   1 MNNSitlTLKNYLGRMPTVNEYYMLKSQVRNIQKIMFFNKDIFISLIKKNKKKFFYEIKSSPSEMRLHILEYFMKQQKTS 80  Yaba monkey tumor vir...
Q08FW1   1 MNRHiseILEKYLGRIPSLTEYHTLKSQYKNIHRVNIFNKDIFISLIKKNKKKFFSDIDTSVSEIKKLVFDYFTKQEQTY 80  Deerpox virus W-848-83
Q8V3R4   1 MNRQianILENYLGRYPSLNEYHTLKSQYRNIQKVNIFNKDIFISLLRKNKKKFFSDLVCTQSDIKHSVLSYFSKQENTY 80  Swinepox virus (strai...
3ERC_C  90 NIGKLFTIIELQSVLVTTYTDILGVLTI 117 Vaccinia virus WR
Q9Q8R9  81 SIGKLYTIIELQTILVSTYTDVLGVLTL 108 Myxoma virus (strain Lausanne)
Q98199  81 KVGRILSIIELQSVLVNSYTEIMGVLTL 108 Molluscum contagiosum virus subtype 1
Q070J7  79 KVGKILSIVEFQHVIVTTFTRVLGVLTI 106 Nile crocodilepox virus Zimbabwe/Ume/2001
Q9J5B8  83 RLGNLFAIMELQKILISSFTKTIGILTT 110 Fowlpox virus strain NVSL
Q6TVV2  78 KLGQILTVLELQSVIVGEFTRTLGSLTT 105 Orf virus
Q6TUY0  81 SIGKLYAIIELQTILVSTYTDVLGVLTT 108 Yaba monkey tumor virus strain VR587
Q08FW1  81 SIGKLYTIIELQTILVTTYTDILGVLTT 108 Deerpox virus W-848-83
Q8V3R4  81 SIGKLYTIIELQTILVTTYTDVLGVLTT 108 Swinepox virus (strain 17077-99)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap