Conserved Protein Domain Family
DUF3772

?
pfam12607: DUF3772 
Protein of unknown function (DUF3772)
This domain family is found in bacteria, and is approximately 60 amino acids in length. The family is found in association with pfam00924.
Statistics
?
PSSM-Id: 403714
View PSSM: pfam12607
Aligned: 49 rows
Threshold Bit Score: 54.6244
Threshold Setting Gi: 356879001
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA229194:W911_12170          183 RKTGELVQVRARQLQTDVQKLRQDLFTQEILNRSPSPLKASTWDKLAYDSPGAWRQIADAASG 245 Hyphomicrobiu...
dbos:1099484000105_PB2503_12849 119 KAQIALNIAEAQRLAIEIANLRRSQFFEDLSARGPSPLQPALLGEAAETSALGFRRYAAALAS 181 Parvularcula ...
WP_014879879                    128 RIVAEEAYSRADGLINEVDKIVRERLTKRLFERGTSPLNPEHWPGALRDLVHASRAVGNETLS 190 Phaeobacter i...
Q167G2                          126 ILAADVAFRRADGLINEIDTILRERETRRLLSLGPSPLNPKTWSVAFGDTERILRDLGDDLSG 188 Roseobacter d...
WP_011750095                    127 GLQAVEAYGRADGIVAQIDQTLRARQTFALIRKTPTPLNPANWGPAMAEAGHVAGQIYAEARA 189 Paracoccus de...
PRJNA212980:JCM7686_1028        120 GLTAVEAFGRADGVVQQIDKTQRERQATALQRLAPTPLNPKNWAPALQEGYQVVAGISNEVMT 182 Paracoccus am...
DSMZRoselon:roselon_02769       165 RIDASQAFTRADGLIAEIDTLLSERQQQQMLELSPSPANPVNWPAALTGLRALAVSLQTDLTD 227 Roseibacteriu...
Q3J4I3                          140 VVSAEEAYQRADGLIREIDRVVRERQTQELLRLWPMPLNPANWPAAASETSTLAVDLWNEGAT 202 Rhodobacter s...
Q5LS48                          132 RIISEEAYSRANGLINEIDRIVRARDTKELLRRGPSPLNPEYWTDAWKDIEQAMRALANEVAF 194 Ruegeria pome...
Q1GGP5                          145 QVLADLGYSRAQGLITEIDKLIRERATRTLLERAPMPVNPEHWPTAFSDTAKVLGAFWYETAT 207 Ruegeria sp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap