Conserved Protein Domain Family
DUF3762

?
pfam12591: DUF3762 
Protein of unknown function (DUF3762)
This domain family is found in viruses, and is approximately 80 amino acids in length. The family is found in association with pfam05533.
Statistics
?
PSSM-Id: 153025
View PSSM: pfam12591
Aligned: 2 rows
Threshold Bit Score: 173.757
Threshold Setting Gi: 81943977
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACH79940  211 PPSMVAIPVPISFGAVPTTAWCSPADAAVLRCRLDYHAAETSFRDERKHVRYVYNDVSSAANRPRTVSPRKCGRVFPSGS 290  Citrus tristeza v...
Q6PXE6     15 HPSMVAIPVPIAFGTMSATAWCSKSDAAVLRCRLNYHAAETDFSTQEKHVRYVYNDVSSAANRPRTVSSRKCGSVFPSKS 94   Citrus tristeza v...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap