Conserved Protein Domain Family
DUF3752

?
pfam12572: DUF3752 
Protein of unknown function (DUF3752)
This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length.
Statistics
?
PSSM-Id: 403688
View PSSM: pfam12572
Aligned: 85 rows
Threshold Bit Score: 76.1763
Threshold Setting Gi: 512194333
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:THITE_2122102  206 PPTSSGYRAA-DptklRARKFASGprAATEakpAGVSSIWTETPEEKAR-----RLANAVLGREDPAAAAAAAGGpsara 279  Thielavi...
EDQ69394           451 PPERQAGGPPaQ----HNTFFSKS--EKSG---RGDTSAWTDTPADKAL-----KAKMQYLEAYKQAALTNGPTDel--- 513  Physcomi...
ERM99234           501 PPERKA-GVSm-----QSMSFSKG--GKEG---RGDTSVWTDTPLDKTQ-----KARMNYLEAYDHAAALGASDGkk--- 561  Amborell...
EFX66823           122 lPELKRKNFGl-----GPRVFNRS--DKPE---VVGRDQWTSTPTSKVQipstsKEKDEDFEAEMRKQY----------- 180  common w...
XP_001628415       221 PPELSK-NFGl-----GPRTFRAK---APT---VGDRSIWTDSPSERAR-----KEAEGGTSRPVDTEEVVYKAP----- 278  starlet ...
XP_001950924       186 PPEKAA-NLGl-----GARQFRKR--EAPD---MSNRSEWTDTPTDKQR-----KVQEPKTAEETDMEALKLIAI----- 244  pea aphid
XP_006006660       204 pPELK--SFGl-----GPRAFKRR--ADTG---SGDRSVWTDTPADREQ-----KAREREEGKLSSTEDRAKSSS----- 261  coelacanth
AFI37638           200 PPEMKD--FGl-----GPRTFKRR--ADDT---SGDRSIWTDTPADRER-----KAKETQEARKSSGKKDEEHIL----- 257  Rhesus m...
XP_010162195        47 PPELK--SFGf-----GPRTFKRR--ADDK---SGDRSIWTDTPADRER-----KAKEREEAKKSTSKDNEEIVL----- 104  chuck-wi...
XP_001744115       174 lPEAYRKNFGm-----DNRSFRQS---YGA---GQVDQSWARAPSSAQPgseapTPQPPSKGPAPQPTVRAAQQQ----- 237  Monosiga...
jgi:THITE_2122102  280 eapgtskssgSSSSRSNgKADEARIRSYMEQ-TRG-RSLVEEHQAARAAGRAAaagkgvdgsrnkwgvkagsggveDEED 357  Thielavi...
EDQ69394           514 ---------eEREKERA-AKEAQLMDSYNSN-KRS-ISLVEKHKAERSAGSkkkskktdkvg---vvsrresekepEWKQ 578  Physcomi...
ERM99234           562 ---------eALARKRD-TATAEIIDAYNKS-KRS-TSLVEKHKQEASKPkkkhk----------------ekvveEWSG 613  Amborell...
EFX66823           181 -----------LEQKRN-KKLEKIVAMYDKTkKRS-ESLLKTHQKEMKSKKD------------------------NSSG 223  common w...
XP_001628415       279 -----------WQEAKD-KHMENVIHSYTEK-HRS-ESLLDQHQKKIKKQKKE-----------------------EDNK 321  starlet ...
XP_001950924       245 -------------QKRD-EEMEKLAETSV---KRKpYSLLEMHQEKLKKQKKEk----------------------IKEE 285  pea aphid
XP_006006660       262 ------------LSERD-KRLAEKVSSYNES-QRS-ESLLDMHQKKLKRKAEE-----------------------GKDE 303  coelacanth
AFI37638           258 -------------SGRD-KRLAEQVSSYNES-KRS-ESLMDMHHKKLKSKAAE-----------------------DKNK 298  Rhesus m...
XP_010162195       105 -------------SGRD-KRLVEQVTSYNES-KRS-ESLMDIHQKKLKSKASE-----------------------EKNK 145  chuck-wi...
XP_001744115       238 ------------------QEAARVVQAYNEK-HRG-QSLVDMHKAKRAKQQET-----------------------SGSK 274  Monosiga...
jgi:THITE_2122102  358 DPSKRAFDWEKDMKVGGRISNSQRKELLNRAANFSGRFQ 396  Thielavia terrestris NRRL 8126
EDQ69394           579 NHPWKPWDREKDLAAGRKSVNLDPKNF---KAELSSRFG 614  Physcomitrella patens
ERM99234           614 QHPWKPWDREKDLTAGRQKVQLDPESM---AEGLSSSFh 649  Amborella trichopoda
EFX66823           224 PKERKPFDRDEDLKL-NQLDNAKRKSLIKKSQELNSKFk 261  common water flea
XP_001628415       322 PQERRPFDRDVDLSS-PGMSAAQRKSLIKKSQELGSRFH 359  starlet sea anemone
XP_001950924       286 PAERRPFSRDIDLQC-NKFDNAQKQSILKKASQLNNRFS 323  pea aphid
XP_006006660       304 PKERRPFDRDQDLRV-HQFDEAQKKSLIKRSKELNSRFS 341  coelacanth
AFI37638           299 PQERIPFDRDKDLKV-NRFDEAQKKALIKKSRELNTRFS 336  Rhesus monkey
XP_010162195       146 PQERRPFDRDQDLKV-NRFDEAQKKALIRKSRDLNTKFE 183  chuck-will's-widow
XP_001744115       275 PAGRRRFDPDVDLH-GTRISADKQRQMIAKASSFQSRFA 312  Monosiga brevicollis MX1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap