Conserved Protein Domain Family
Hemolysin_N

?
pfam12563: Hemolysin_N 
Hemolytic toxin N terminal
This domain family is found in bacteria, and is approximately 190 amino acids in length. The family is found in association with pfam07968, pfam00652. This family is a bacterial virulence factor - hemolysin - which forms pores in erythrocytes and causes them to lyse.
Statistics
?
PSSM-Id: 403679
View PSSM: pfam12563
Aligned: 2 rows
Threshold Bit Score: 319.343
Threshold Setting Gi: 134048491
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P55870   9 FitQAPTLSLLA-LALLAGSVQAEDIGERTDQGTAMLASLQSEQGLIYLNADVWLKRQGATPLMTrdQLRERVLARGERL 87  Aeromonas hydrophila ...
P09545   4 L--NRCAIAIFTiLSAISSPTLLANINEPSGEAADIISQVADSHAIKYYNAADWQAEDNALPSLA--ELRDLVINQQKRV 79  Vibrio cholerae O1 bi...
P55870  88 FIDFSAVTDQSERQQTRKAMEQLAGISFDADWVLVSGYKGELLFTPLGGVDDPAfyqvMERVESLEGQGKRHKRSLTQPP 167 Aeromonas hydrophila ...
P09545  80 LVDFSQISDAEGQAEMQAQFRKAYGVGFANQFIVITEHKGELLFTPFDQAEEVD----PQLLEAPRTARLLARSGFASPA 155 Vibrio cholerae O1 bi...
P55870 168 AAE---AGLPHVAFYLNVNRKISDAECTFPRS 196 Aeromonas hydrophila subsp. hydrophila ATCC 7966
P09545 156 PANsetNTLPHVAFYISVNRAISDEECTFNNS 187 Vibrio cholerae O1 biovar El Tor str. N16961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap