6OEM


Conserved Protein Domain Family
RAG1_imp_bd

?
pfam12560: RAG1_imp_bd 
RAG1 importin binding
This region of RAG1 is responsible for binding to importin alpha.
Statistics
?
PSSM-Id: 403677
View PSSM: pfam12560
Aligned: 18 rows
Threshold Bit Score: 335.932
Threshold Setting Gi: 556948320
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OEM_A         12 SSAPDEIQHPQIKFSEWKFKLFRVRSFEK-APEEAQK-EKDSSEGKPYLEQSPVVP-EKPGG--QNSILTQRALKLHPKF 86  
XP_003773737   12 SSAPDEIQHPYMKFSEWKFKLFKVRSFIKpPPEEAQGpNKNLGEGQASLEETPAVIsSANIPapEKPALIQPTFSALPKS 91   Tasmanian devil
Q28463         12 RPVPDEIQYPHMKFSEWKFKLFKVRSSVKpSPGEAQGpSKNTMEGQSSLEETPVVIcNTNIPapEKPALVQPTFTANSKS 91   gray short-ta...
NP_001243830   12 NSAPDEIQHPHIKFSEWKFKLFRVRSFEK-APEEAQKeKD-SSEGKPSLEQSPAVL---DKAggQKPVLTQPAVKPHPKF 86   horse
XP_540538      12 TSAPDEIQHPHIKFSEWKFKLFRVRSLEK-APEEAQIeKKVSSEGKPSLEQSPAVP---DKAdgQEAALSPPALKAHPKF 87   dog
P15919         12 SSAPDEIQHPQIKFSEWKFKLFRVRSFEK-APEEAQKeKD-SSEGKPYLEQSPVVP---EKPggQNSILTQRALKLHPKF 86   house mouse
XP_003214699   12 cfvsEQTQLPYKKFAEWKFKLFKVRSIEKpLPDGSHLaNNNKGKVAASLDQVIEEKtD-MVAlsHSPFETDTELNKSIQT 90   green anole
XP_002199718    7 MDLPEELQHTYTKFSEWKFKLFKLRSFEKtPSDDSQHiHKDQAEEAVSSNKEIILHkDEAVPrgEKTELT-----GNRQG 81   zebra finch
XP_010709561    7 MDLPEEIQHPYAKFSEWKFKLFKVRPFQKaPSDKSQCiNKDQEQEVASTDQNITLHkDEEVPrgEKLILTQMDFMGNTQA 86   turkey
XP_005802328   13 SFMPAELQHPHSKYSQWKFKLFRVKSMEK-APLPSETqTEIGASLGISPPTAPNIEaDHGGG------------------ 73   southern plat...
6OEM_A         87 SKKFHADGKSSDK---------------AVHQARL----------RHFCRICGNRFKSdGHSRRYPVHGPVDAKTQSLFR 141 
XP_003773737   92 LEKPADVGKTREK---------------AIHLASL----------RQLCRICGVSFRAdGQNRRYPVHGPVDNKTQSLLR 146  Tasmanian devil
Q28463         92 LEKPADIGKAGEK---------------AIHQASL----------RQLCRICGASFRAdGQNRRYPVHGPVDSKTQGILR 146  gray short-ta...
NP_001243830   87 LKKSHDDGKAREK---------------AIHQASL----------RHLCRICGNSFKTdGHNRRYPVHGPVDGKTQVLLR 141  horse
XP_540538      88 LKEPHDDGKTRDK---------------AIHQANL----------RHLCRICGNSLKTdRRNRRYPVHGPVDGKTQVLLR 142  dog
P15919         87 SKKFHADGKSSDK---------------AVHQARL----------RHFCRICGNRFKSdGHSRRYPVHGPVDAKTQSLFR 141  house mouse
XP_003214699   91 IDKGAFHVSQREA---------------ETHQENL----------QHLCRICGGSFKTdPYKRSHPVHGPIDDDMKALLR 145  green anole
XP_002199718   82 LEEDAHAMKTQDI---------------RAHQNNL----------KQLCRICGVSFKTdCSQRTYPVHGPVDDETLCLLR 136  zebra finch
XP_010709561   87 LEKNVNDMKIQDN---------------TVHQNNL----------KQLCRICGASFKTdCYKRTHPVHGPVDDETLCLLR 141  turkey
XP_005802328   74 -------LASVMKlclggkskenvegagKRVDMKLqemdthmnhlRCLCRICGMVLRK-VKGPVHDVHGDLDDASKCVLR 145  southern plat...
6OEM_A        142 KKEKRVTSWPDLIARIFRIDVKADVDSIHPTEFCHDCWSIMHRkfssSHSQVYFPRKVTVEWHPHTPSCDICFTA----- 216 
XP_003773737  147 KKEKKVTSWPDLIAKVFKIDVKGDVDSIHPTQFCHSCWNIMYGrfsnAPCEIHFPRKAAIEWRPHTPDCDSCQAA----- 221  Tasmanian devil
Q28463        147 KKEKKVTSWPDLIAKVFKIDVKGDNDSIHPTQFCHNCWNIMYGrfsnSPHEVYFPRNATIEWHPHTPSCDICQAA----- 221  gray short-ta...
NP_001243830  142 KKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCWSIMHRkfssAPCEVYFPKNATMEWHPHTPSCDICHTA----- 216  horse
XP_540538     143 KKERRATSWPDLIAKVFRIDVKADVDSVHPTNFCHKCWKVMYRrfssAPRGVCFPRKAAPEWLPHAPSCDLCRAA----- 217  dog
P15919        142 KKEKRVTSWPDLIARIFRIDVKADVDSIHPTEFCHDCWSIMHRkfssSHSQVYFPRKVTVEWHPHTPSCDICFTA----- 216  house mouse
XP_003214699  146 KKEKKATSWPDLLAKVLKIDVKGDIDTIHPTKFCHQCWTVIQKklsnSPYEIFFPKKGPMEWQPHSTSCDVCGTS----- 220  green anole
XP_002199718  137 KKEKTATSWPDLIAKVFKTDVRGDVDTIHPTRFCHNCWSIIHRkfsnTLCEVYFPRNSTMEWQPHSPNCDVCHTT----- 211  zebra finch
XP_010709561  142 KKEKKATSWPDLIAKVFKIDVRGDVDTIHPTRFCHNCWSIIHRkfsnTPCEVYFPRNSTMEWQPHSTNCEVCHTP----- 216  turkey
XP_005802328  146 KMGCKFTSWPDILLKVFKVDVTEDAESIHPLSFCHRCWLAAIR----GGGVCSFTRTKVPEWKPHTSHCYLCSPKkssfq 221  southern plat...
6OEM_A        217 -------------------------------------------HRGLKRKRHQPNVQLSKKLKTVLNHARRDRRKR---- 249 
XP_003773737  222 -------------------------------------------RRGLKRKGHQSNLLLSKKLKTVIKQTRRAHPSKsq-- 256  Tasmanian devil
Q28463        222 -------------------------------------------RWGLKRKGRQSNPSLSKKLKAMADRARRARLPKsq-- 256  gray short-ta...
NP_001243830  217 -------------------------------------------RQGLKRKSHQPNVQLSKKLKTAVDRARQARQHKrr-- 251  horse
XP_540538     218 -------------------------------------------RQGLKRKSPQPSAQLSKRLRTVLERAGRARGHRrr-- 252  dog
P15919        217 -------------------------------------------HRGLKRKRHQPNVQLSKKLKTVLNHARRDR--Rkr-- 249  house mouse
XP_003214699  221 -------------------------------------------PRGVKRKKQVLNPQLNKKMRMMAGRARKIRQIRnt-- 255  green anole
XP_002199718  212 -------------------------------------------RRGVKRKSQPPSVQRGKRVKTTVERAQLNRGVKnqql 248  zebra finch
XP_010709561  217 -------------------------------------------RRGVKRKSQPPNVQHGKRVKITAERARVSRGIKnq-- 251  turkey
XP_005802328  222 rtgrkrrkvvpkvqslakrarwdhgdtiavgekralrpfgdlhSPVLra------------------------------w 271  southern plat...
6OEM_A        250 TQARVSSKEVLKKISNCSKIHLSTKLLAVDFPAHFVKS 287 
XP_003773737  257 vqPRNGGKDRMKKITNCSKMHLSTKLLAVDYPVDFVKA 294  Tasmanian devil
Q28463        257 aqPRKSSKDLMKKLTNCSKMHLSTKCLAVDYPVDFVKA 294  gray short-tailed opossum
NP_001243830  252 aqARISGKGVLKKITNCSKIHLSTKLLAVDFPAYFVKS 289  horse
XP_540538     253 arAGLRDSGATGKASDCGNVHLGTELLAVDFPAHFVKS 290  dog
P15919        250 tqARVSSKEVLKKISNCSKIHLSTKLLAVDFPAHFVKS 287  house mouse
XP_003214699  256 --kqVNQKSLMKKIASCKKIHLSTKILAVDYPSDFVKS 291  green anole
XP_002199718  249 KQAQINNKNLMKEIVNCKDIHLSTKLLAVDYPVDFIKS 286  zebra finch
XP_010709561  252 --vlINNKNVMKEITNCKNRHLSTKLLAVDYPADFIKS 287  turkey
XP_005802328  272 KKNGIQREQWVKNITHCQNDHLNTKLIAEKLPTDFIIS 309  southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap