Conserved Protein Domain Family
MOZART1

?
pfam12554: MOZART1 
Mitotic-spindle organizing gamma-tubulin ring associated
The name MOZART is derived from letters of 'mitotic-spindle organizing proteins associated with a ring of gamma-tubulin'. This family operates as part of the gamma-tubulin ring complex, gamma-TuRC, one of the complexes necessary for chromosome segregation. This complex is located at centrosomes and mediates the formation of bipolar spindles in mitosis; it consists of six subunits. However, unlike the other four known subunits, this family does not carry the conserved 'Spc97-Spc98' GCP domain, so the TUBCGP nomenclature cannot be used for it. MOZART1 is required for gamma-TuRC recruitment to centrosomes.
Statistics
?
PSSM-Id: 403672
View PSSM: pfam12554
Aligned: 57 rows
Threshold Bit Score: 44.7827
Threshold Setting Gi: 74602510
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGV63973      32 NANSMVTELVRLLNVDeVDDVTLQLCIKLLDQGVDPKQLARDILSI 77  Yamadazyma tenuis ATCC 10573
XP_002026235  14 RIWDVLCGMLDCVNSG-LAPESVRICMQLMGNGVQPKQLAEIIRTL 58  Drosophila persimilis
XP_002065642  28 lLMEILYGMSTLINTR-LSKEALILCIELLEVGVNAKVLAQVVLKI 72  Drosophila willistoni
2_pfamImport   2 VIRTSIQGISQLLNTG-LDSYSLELCMKLLEAGIHPQALADVVNEI 46 
XP_001848899  41 TIRANIQNISQLLNTG-LTPEALDICVKLLEAGVHPQALAEVVTQI 85  southern house mosquito
XP_002053764 184 SLRIAVHGMSELINTR-LSTEALEICLELIEAGVQPRALAEVVLHI 228 Drosophila virilis
XP_001993707  43 ELRIAVHGMSSLINTR-LSSEALQTCLALIEAGVHSKALADIVMHI 87  Drosophila grimshawi
EDW50198      12 DRLTILQTISDVLNSG-LSKESLKICIELVDNGVSGGALAHVIQTI 56  Drosophila sechellia
XP_001955889  35 KLLTVVHALSDLVNTG-LSRESLKICTELLRAGVDAKSLTKVIKTI 79  Drosophila ananassae
3_pfamImport   1 -SFTMVVEMSNLLKCD-IDLEELTIAYRLIESNVNSKLLAHAIKSM 44 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap