Conserved Protein Domain Family
DUF3742

?
pfam12553: DUF3742 
Protein of unknown function (DUF3742)
This domain family is found in bacteria, and is approximately 50 amino acids in length. There is a single completely conserved residue Y that may be functionally important.
Statistics
?
PSSM-Id: 372185
View PSSM: pfam12553
Aligned: 16 rows
Threshold Bit Score: 91.0137
Threshold Setting Gi: 640469740
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q889B5           1 MSTDANTDLr-gAARFGHLLGHGLRRILNVERAFWSLFDRTGVPRVIVTPVKWCARAAVIGTGAFFVAWGLLyVLAVVCF 79  Pseudomonas s...
WP_012639403     1 MNATPRTTK---AERAGRWLGHAWRGLARQEARAIQWLAGKGLPAGVARLLLWIVKLVVFGVLLYAAFWLAL-LLAFALL 76  Thioalkalivib...
Q5P576           1 MKPAAQTTF---AERVGRTLGRLWRGCVRLDRRATHRLVAKGWAPGVAKAVILLVKLAAIGVLLFAAFWSALvALGIVVV 77  Aromatoleum a...
jgi:Tmz1t_0940   1 MKPVVHTTF---AERLGRMLGQAWRGCVRLDRRANGWLVAQGWTPNVAKVVLAVIKLTALGILLYVAFWLAL-LIGGILA 76  Thauera sp. MZ1T
Q5P5F2           1 MKTTAHTRF---AEHAGRSLGRMWRVLVRLDRKAQGGLVTQGWSLGAASAALLVTKLVLFGVLAYVAFWPAM-SLALLAL 76  Aromatoleum a...
CAP41714         1 MNTTTRSST---AERFGHKLGRTSRAYRHCERRVVAWLISVGAPSAVATALVWVVKLAVLGILLYAAFWLAL-LLLFAVA 76  Bordetella pe...
jgi:Tola_2452    1 MNTTTRSST---AERLGRWLGRGWRGYVRRERRVAAWLVSAGAPNGVATALVWIVKLAVLGVLLYVAFWLTL-LLVFATV 76  Tolumonas aue...
jgi:Rmet_2361    1 MSTTTRIST---AERLGRALGRGWRAYARSERRASNWLVSKGVPLAAAAALLWAGKLAVLGLLLYVAFWLAL-LLVALVF 76  Cupriavidus m...
WP_014159637     1 MGTKTRISN---AERFGRWAGGMWRGGVRRERRLAGRLVARGLPPGAATALLWLVKLAVLGVLLYAAFWLAL-LLVFAVA 76  Pseudoxanthom...
CDM25639         1 MSMTTNTHNgrwSHRLGPGAGRAWRGYLRREQRVAGWLVTRGVPAGAATAVLWIVKLAVLGALLYSAFWLAL-LLAFAVI 79  Castellaniell...
Q889B5          80 IAIAIGFVTNpDIERSlrgsqlvhfdgdgfgdeEDLtsskvkRNGVDGFGNYIGGV-RVD 138 Pseudomonas syringae pv. tomato
WP_012639403    77 AAWLVRNADL-DEEKQ-----------------PEL------RDGHSGAGVYDKDDwRID 112 Thioalkalivibrio sulfidiphilus
Q5P576          78 AAWTARSLDDeDDSISq----------------TEW------RYGPAGYGLYTSNEqRID 115 Aromatoleum aromaticum EbN1
jgi:Tmz1t_0940  77 AAWIARQDNT-EGDSDflg------------rkAEE------RDHREGLFYHptmhnddp 117 Thauera sp. MZ1T
Q5P5F2          77 VAWNMRGSATwDAEGKd---------------ePEW------REGHGGFGLYDKNEwRHD 115 Aromatoleum aromaticum EbN1
CAP41714        77 AAWMAGHDDA-TEEKMgvf-----------ttqEDL------RETP-GY----------D 107 Bordetella petrii
jgi:Tola_2452   77 AAWASAANTP-DEDVWpft------------diDEL------RNTP-GY----------D 106 Tolumonas auensis DSM 9187
jgi:Rmet_2361   77 V---ARGHDT-VEWEPp---------------ePEW------RHGHAGFGLYTHDEyRID 111 Cupriavidus metallidurans CH34
WP_014159637    77 AAWAMQHGTAdQEEPDlln------------rqAEE------RDHREGLFYHpasynddp 118 Pseudoxanthomonas spadix
CDM25639        80 AAWMVRNVDA-DESSDdd--------------ePQW------RNGLDGYGLYRGEV-RID 117 Castellaniella defragrans 65Phen
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap