1WV3


Conserved Protein Domain Family
FtsK_SpoIIIE_N

?
pfam12538: FtsK_SpoIIIE_N 
Click on image for an interactive view with Cn3D
DNA transporter
This domain family is found in bacteria, and is typically between 107 and 121 amino acids in length. The family is found in association with pfam01580. The FtsK/SpoIIIE family of DNA transporters are responsible for translocating missegregated chromosomes after the completion of cell division.
Statistics
?
PSSM-Id: 372173
View PSSM: pfam12538
Aligned: 12 rows
Threshold Bit Score: 107.09
Threshold Setting Gi: 85543904
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WV3_A          4 LIIKYNKQLKXLNLRDGk---TYTISEDERADITLKSL---GEVIHLEQNNQGTWQANHT--------------SINKVL 63  
Q5WK75          4 LWVFYDSYVQQLDLSQA----ERLLGASEDVDLLVPPL---HAKIRAKMASDQKQCVLDIegag------eqilAAGESF 70   Bacillus clau...
Q9KE81          5 LWIFYDQYVQRATVDGL----PTFIGPGEQATLRISSL---KNDIQVR--DQDGQCLIMTdgee------lhtlPSGESC 69   Bacillus halo...
WP_012957310    4 LFVFYKDTYQLYPLDHHk---RVTIGNSEEHSLTVYSYpfaSGELSIVKEDE---YVLYQeger------ltelKIEEPF 71   Bacillus pseu...
ABV63512        4 LWVFYEEDYQTVRLDEQfn-rEAVIGPEIEYTVTIPSLsfdEGVIRLTPDEPNDGFSIYQgeekkgtllphepyKLG--- 79   Bacillus pumi...
Q65FF7          4 LWIFYHKNYQKIKLDDQns-rTLTIGPDLKHSVTIKHFsfeKGPVTLEKQKDSDALNVQLgget------vsslKLGGKA 76   Bacillus lich...
Q2G184          4 LIIKYNKQLKMLNLRDGk---TYTISEDERADITLKSL---GEVIHLEQNNQGTWQANHT--------------SINKVL 63   Staphylococcu...
Q813N4          5 LVLTYGDKIYKCTLHPNeq-sIVSIGKEWTNDITNPSL---EQEVELKWNNE-----VNAwmvq------dqliEFNKEI 69   Bacillus cere...
Q8ERI6          6 LFVAFQDQLHKCHLPDStn-rLITIGNSWSNQVTIPEM---DEEITLEWDGSKLIYLDT---------------EINKME 66   Oceanobacillu...
Q8YAQ5          7 LIVSNGQQCHKNHLSPEk---VVTIGNTIEHEITYPEL---AESIEVKYDEG-------Swnag------ttalQANQAV 67   Listeria mono...
BAK15727        4 LIFFYDNYYQSIDLNQLkk-nSITVGNNSSDTVTIQSIpftDGPLQIT--EDSFGFTVKQsgsqlgkvnpkqffEWKDS- 79   Solibacillus ...
C0SPA7          4 LWVFYQNNVQKLNLSNLpsshPVTIGPDVKDSVTISTIpfnSGVISLKRKESGGQYEVFLgndc------lgtiETDISF 77   Bacillus subt...
1WV3_A         64 VRKGDLDDITLQLYTEADYASFAYPSIQDTXTIGPNA--YDDXVIQSL 109 
Q5WK75         71 QYKENDAAVTFVYKNEAASERMYFIGEETFLSIGPEE--SADIVLPSE 116  Bacillus clausii KSM-K16
Q9KE81         70 ELTIDGKPYSFLYVGEAPSEKKYYMGHANLVTISNEP--SANIVLPSD 115  Bacillus halodurans
WP_012957310   72 TLTEEGHSLTFILKGGSNAEATYYVGHQKEITVDHKE--GATIVLLnq 117  Bacillus pseudofirmus
ABV63512       80 -------PLTLILMEAHHNQHIYYLGNRVELSFSREKkdEIDVWKEQA 120  Bacillus pumilus SAFR-032
Q65FF7         77 SVQSGAEQLTLFLAEEADSVPAYYLGERQEIVISSLDq-EADVYFNET 123  Bacillus licheniformis DSM 13 = ATCC 14580
Q2G184         64 VRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNA--YDDMVIQSL 109  Staphylococcus aureus subsp. aureus NCTC 8325
Q813N4         70 EIGKTRDVSLKIFISIVGTTRVFDIGTKHSLTVSQND--YDDISITGT 115  Bacillus cereus ATCC 14579
Q8ERI6         67 RVDLKDKTI-HFYVQDEEQTIYYDIAGYHSITFGSQE--YNDVSISSW 111  Oceanobacillus iheyensis
Q8YAQ5         68 NVEN-----LAFYLCQDLHTQVYDVVTNISVTFGVGI--ENDVTLDDT 108  Listeria monocytogenes
BAK15727       80 ---TGKKMLKIILFLSRPSSETYFVGNRTEISLSTIDg-QADVVWQSE 123  Solibacillus silvestris StLB046
C0SPA7         78 TLQTDQQDIRLILTGSEPEKSVYFTGNRDEIVCSSEKt-NADIYLNPQ 124  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap