5ZSU


Conserved Protein Domain Family
Pannexin_like

?
pfam12534: Pannexin_like 
Pannexin-like TM region of LRRC8
Pannexin_like is a family of the four transmembrane domains of metazoan leucine-rich-repeat-containing 8 proteins. These four TMs associate into hexamers resulting in homo- or heteromeric channels that connect the cytosol to the extracellular space. The family is found in association with pfam00560.
Statistics
?
PSSM-Id: 403656
View PSSM: pfam12534
Aligned: 44 rows
Threshold Bit Score: 384.649
Threshold Setting Gi: 156210014
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZSU_A         1 MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCK---------------------- 58 
8_pfamImport   1 MFSLSELAPLNQHQGRCKLLKPWWEVFMDYLVVLMLMVSVLACTEQLSRDRVVCIPMDpvt------------------- 61 
XP_004072021   1 MFSLSELAPPNQHESRCKLLKPWWEVFMDYLVVLMLMTSVLACTEQLSRDRIVCIPVDpl-------------------- 60  Japanese medaka
XP_007229860   1 MFTLSELWSISERQGRYKLLKPWWEVFMDYLVLLMLMVSILAGTLLLSRDGVVCVPV----------------------- 57  Mexican tetra
XP_688470      1 MFALSELWSGGERQGSYKLLKPWWEVFMDYLLVLMLMVSILAGTLLLSRDGVVCVPV----------------------- 57  zebrafish
XP_006002308   1 MLPVSDISFLGESQITHRIFKPWWDILMDYIIYSLMILSVIGGADLLFPNVVLCLPM----------------------- 57  coelacanth
XP_014347654   1 MFTVTDVAFIGESQASNKILKPWWDVLMDYLVFSMLMLSIFSGTLLLLKDAVACVPMDfperg----------------- 63  coelacanth
XP_007245147   1 MFTLTEVASLNDVQPTYRILKPWWDVFMDYLGLVMLMLAIFAGTMQITKDQVACLPFLeerskiesttpytthgsmytst 80  Mexican tetra
XP_002660860   1 MFSLTEVASLNDIQPTYRILKPWWDVFMDYIGVIMLMLAIFSGTMQLSKDQVACLPILekninlegaqnr-----pecsl 75  zebrafish
XP_003443213   1 MFSLSELAPLNQHQNRSKLLKPWWEVFMDYLVVLMLMTSVLACTEQLSRDRVVCIPLDst-------------------- 60  Nile tilapia
5ZSU_A        59 -------WVTKDSCNDSFRGWAAPgpepty--pnstilPTP-DtgPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYL 128
8_pfamImport  62 ----sanTSNHGPSTSGP-ALTPSskppthvprnvspkLPP-V--GRGRRTHLAHQQYVYISQVCYHEALPLCSRFFPYM 133
XP_004072021  61 -----spPCMSNHSMAQNSDVKPSpapkstnpqnpgpnFYS-A--PRGRRTHLVHQQYIYISQVCYHEALPFCSRFFPYI 132 Japanese medaka
XP_007229860  58 ----------HSLSNNYSSGFRTPsdspvlpftsgsalAEG-P--AKGRRTNMDYQQYVYISQVCYHEALPWFSRFLPYI 124 Mexican tetra
XP_688470     58 ----------HSFPTNHTSTIDPIpet---------afTST-S--ARGRRTNLDFQQYSYISQVCYHEALPWYSRFLPYV 115 zebrafish
XP_006002308  58 --------EQFGEGDDLAQRVSVAadamkvylesaqreMNP-D--LKPPNTNLDLQQFYYINHVCYEKAFPWFSRYFPYV 126 coelacanth
XP_014347654  64 --nsvptAASTQNSESTPSHLDPTaqahtifastsepsFIPeT--VRGRPTKLDYQQYVYINQVCYQKAVPWYSKYFPYL 139 coelacanth
XP_007245147  81 sslgtapLATQDLPDSVVHELHHTepttparsqsimtaTEP-Q--PKGRRTNLDYQQYIFVNQMCYHVALPWYSKYFPYL 157 Mexican tetra
XP_002660860  76 svlgtgpSTTKDLPDSVANELLNTqpaplp---kegvwTQP-Q--PTGVKTNLDFQQYVFVNQKCYHDALPWFNKYFPYL 149 zebrafish
XP_003443213  61 -----tnTTDHSHSKSANVGLSPSsqpqihhahkigpnLHS-A--PRGRRTHLVYQQYIYISQVCYHEALPLYSRFFPYM 132 Nile tilapia
5ZSU_A       129 VLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFS-------------------- 188
8_pfamImport 134 AMLQSLVLVASGSFWLHFPHTSARIEHFLAILAKCCESPWTSQALSHAARQDSIQEKEVV-------------------- 193
XP_004072021 133 ALLQSLVLVASGSFWLHFPDTSSRIEQFLSILAKCCESPWTSQALSHAARQENIQELEKA-------------------- 192 Japanese medaka
XP_007229860 125 TLLQSLVLLASGCFWFHFPLTSARIEHFLAILAKCCESPWTSRALSRTAKLDSAHNRPHE-------------------- 184 Mexican tetra
XP_688470    116 TLLHTLVLLASGCFWFHFPLTSARIEHFLSLLAKCCESPWTTRALSHTAKLDTRFSEAEP-------------------- 175 zebrafish
XP_006002308 127 VLIHSIVLLVSNNLWFQFPKTSAKIELLVSVLEKCFESPWTIKALSKKSGKKESNGIQn--------------------- 185 coelacanth
XP_014347654 140 ALMHSLVLLVSNNFWFRYPKTSSKIEHFVSILGKCFESPWTTKALSETACEDSESN------------------------ 195 coelacanth
XP_007245147 158 VLIHTILLMVSSNFWFKYPKTSSKIEHFVSILGRCFESPWTTKALSETACEDSEESKQRI-------------------- 217 Mexican tetra
XP_002660860 150 ALIHTIMLMVSSNFWFKYPKTSSKIEHFVSILGRCFESPWTTKALSETACEDSEGNKQRF-------------------- 209 zebrafish
XP_003443213 133 ALLQSLILVASGSFWLHFPHTSSRIEQFLAILAKCCESPWTSQALSHAAHQESIQEMVEEgrrahqphhrtstsptvtht 212 Nile tilapia
5ZSU_A       189 ---------------KMNGSM---------------------------------DK-------KSSTVSEDVEATVPMLQ 213
8_pfamImport 194 ---------------EEERRApqppl--------------------------------ssassSHPVTLARRTSRDSGTD 226
XP_004072021 193 ---------------ERQPFLsaasswvtrtrrsst---dsgsvspllkrsevaPSpaspspcPSLLSSNSSVSSLSVGS 254 Japanese medaka
XP_007229860 185 ---------------EEQVVKpqahpiltsitrqssmdsgtdspllvrtgststTAaqpspcpSSLSRCSTLSSLSIPEP 249 Mexican tetra
XP_688470    176 ---------------VVQPKAqvassykmrkssl-------dsgtdspllagidTAstttqpsPCPSTVSHCSAFSTRSL 233 zebrafish
XP_006002308 186 --------------------------------------------------------------rLSVLARNRFSVNLQKDT 203 coelacanth
XP_014347654 196 ------------------------------------------------------PNrlnvsipKHSDTEAKEGIDIPLVP 221 coelacanth
XP_007245147 218 ---------------IAGQTS---------------------------------SKqv---stDSQEEATSPTSPMLINT 246 Mexican tetra
XP_002660860 210 ---------------TGGSVY---------------------------------HKhv--------ssEDSQSTPLVETP 233 zebrafish
XP_003443213 213 rhssidsgtdspllkRMDSACatpp--------------------------spcPStlscnstVSCVSLDSREQLPSSSP 266 Nile tilapia
5ZSU_A       214 RTKSRIEQGIVDR-SeTGV---LDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIICYTVYYVHNI 289
8_pfamImport 227 SPLL-------ESpRqVMS---LDKSDGEQARALFERVRKFRSHSESSDVIYKVYLAQTVLKLLMVTLILSYSIPLLSSL 296
XP_004072021 255 GVHCPSSKAGPDSpReVMS---LDKSDGEQARALFERVCKFRSHCESSAVIYKVYVAQTTFKLFLVLLILSYTIPLLNSL 331 Japanese medaka
XP_007229860 250 ASLPKPAPVVPEGsRpGPT---LDRSDGEQARALFERVRRFRAHCESSDIIYKVYVAQTVFKVLKFVVIVSYTAPLLGSI 326 Mexican tetra
XP_688470    234 TEPVHAVQVSPDRsRpGAT---LDRSDREQARALFERVRRFRAHCESSDVIYKVYTAQTVFKVLKFVLIVSYTTPLLSCI 310 zebrafish
XP_006002308 204 DNPSAPSNQVSAKnPtSKVpvhFNKTAGVQAKALFVRARRIHAYIERWDFIYKFYVGQSMFKALMFIVPLLLTSAMLDNV 283 coelacanth
XP_014347654 222 NPEASFEKPVFEVpS-VTI---LDKTDGEQAKALFEKVRKFRAHIEETDFTYKFYVGQAVFKVVKFLVVLSYTCTIVDHI 297 coelacanth
XP_007245147 247 EVTFSTERMVPEGqS-LTI---LDKKDGEQAKALFEKVRTFRAHVEDSDFIYNLYVAQTSVKALKLIFILCYTSTFTSEI 322 Mexican tetra
XP_002660860 234 TAPFSTEKLIAEApS-LTT---LDKKDGEQAKALFEKVRKFRAHVEDSDFIYKLYVAQTAIKALKVILILSYTSTFAAEI 309 zebrafish
XP_003443213 267 SVMA-------DShSqVIS---LDKSDGEQARALFERVRKFRSHCESSAVICKVYLAQTVFKLLIVTLIMSYTVPLLGSL 336 Nile tilapia
5ZSU_A       290 KFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTL 340
8_pfamImport 297 SFTHTCHPEETALVGYDTFQCIHVLSSLLRKLLMAYLSLLGLYAMLNFYTL 347
XP_004072021 332 SFNHVCRPEEWELVGYATFECVHVLSSLLHKLLVAYLILLGLYTLLNLHTL 382 Japanese medaka
XP_007229860 327 SFNHICQPHSHTLTGYQVFQCSHSLASVLRKLMLAYVSLVGLYGLLGIYTL 377 Mexican tetra
XP_688470    311 SFSHVCRPHSDALIGYSEFQCSHPLSSVLRQLMQAYVSLLFLFGLLAIYAL 361 zebrafish
XP_006002308 284 SLISICKPKIRNLTGYSRFYCIHNYAFLTKSLMVTYIVLIGVYGLIGIYVL 334 coelacanth
XP_014347654 298 QFFYICKPKIRNLTGYSKFYCTHNLAFVISKLLITYMILIIIYGLLSIYNL 348 coelacanth
XP_007245147 323 KFKHVCKPEIEHLTGYDEFFCTHNMAFMLRKLLFTFMAIISLYGLVCMYAL 373 Mexican tetra
XP_002660860 310 SFCHICKPKVESLTGYDQFFCTHNMAFMLRKLLFTFMAMICLYGLVCLYTL 360 zebrafish
XP_003443213 337 SFNHTCHPEERALVGYATFECIHVLSSLLRKLLVAYLTLLGLYGLLNFYTL 387 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap