Conserved Protein Domain Family
DUF3725

?
pfam12523: DUF3725 
Protein of unknown function (DUF3725)
This domain family is found in viruses, and is approximately 70 amino acids in length. The family is found in association with pfam01577. There is a conserved FLE sequence motif.
Statistics
?
PSSM-Id: 152957
View PSSM: pfam12523
Aligned: 4 rows
Threshold Bit Score: 127.659
Threshold Setting Gi: 123809908
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACA42550   41 HVGEFIVSEGAKILQLVQIGNATIGRTFLEGDRRVRADIFEIVKKTMVGHLGYDFESELWFCHSCDNTSDKYFK 114  Papaya ringspot virus W
Q6T3S2     41 YCSEFHISKGAKILQLVQIGDAEIGRAFLEGNKFIRANIFEIIPKTMVGRLGYDFDNELWVCHNCDKTSEKYFK 114  Papaya ringspot virus P
Q1G2C1     41 CWTHFKVCDGACYAYLLVHFTEEGAREFLELSAGRRKLVLDNVRRALCSALYYNPNEEDFEC-ECGNSNTSWKR 113  Cucumber vein yellowing...
Q19RA3     33 YYSEFDISKGAKILQLVLIGNAEVGKTFLEGNRFVRANIFEIIRKTMVGRLGYDFESELWFCHNCNETSEKYFK 106  Papaya ringspot virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap