6V1V


Conserved Protein Domain Family
Vip3A_N

?
pfam12495: Vip3A_N 
Vegetative insecticide protein 3A N terminal
This family of proteins is found in bacteria. Proteins in this family are typically between 170 and 789 amino acids in length. The family is found in association with pfam02018. Vip3A represents a novel class of proteins insecticidal to lepidopteran insect larvae.
Statistics
?
PSSM-Id: 403628
View PSSM: pfam12495
Aligned: 13 rows
Threshold Bit Score: 276.117
Threshold Setting Gi: 154183766
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6V1V_A        26 ALPSFIDYFNGIYGFATGIKDIMGMIFKTDT-GGsNLTLDEILKNQNLLNDISGKLDGINGDLGDLIAQGNLNSELAKEL 104
Q4U3F4        12 ALPGFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
ABS70723       1 SLTSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEI 78  Bacillus thurin...
Q58XI2        12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
ACB41771      12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
ABX90027      12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
Q5JZY9        12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GS-NLTLDEILKNQQLLNEISGKLDGVNGSLNDLIAQGNLNTELAKQI 89  Bacillus thurin...
Q5PXG4        12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDTgGG-NLTLDEILKNQDLLNQISDKLDGINGDLGDLIAQGNLNSELTKEL 90  Bacillus thurin...
WP_003308333  12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-NLTLDEILKNQQLLNEISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
ADY76642      12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-NLTLDEILKNQQLLNEISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
Q108N9        12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-NLTLDEILKNQQLLNEISGKLDGVNGSLNDLIAQGNLNTELSKEI 89  Bacillus thurin...
ABR22260      12 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDT-GG-DLTLDEILKNQQLLNDISGKLDGVNGSLNDLIAQGNLNTKLSKEI 89  Bacillus thurin...
ABO30520      10 ALPSFIDYFNGIYGFATGIKDIMNMIFKTDTgGG-NLTLDEILKNQDLLNQISDKLDGINGDLGDLIAQGNLNSELTKEL 88  Bacillus thurin...
6V1V_A       105 LKISNEQNQMLNHVNAQLNAINSTLNIYLPKITSMLNEVMKQNHVLSLQIEFLSKQLQEISDKLDIINLNVLINSTLTEI 184
Q4U3F4        90 LKIANEQNQVLNDVNNKLDAINTMLRVYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
ABS70723      79 LKIANEQNQVLNDVNNKLDAINTMLRVYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 158 Bacillus thurin...
Q58XI2        90 LKIANEQNQVLNDVNNKLDAINTMLRVYLPKLTSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
ACB41771      90 LKIANEQNQVLNDVNNKLDAINTMPRVYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
ABX90027      90 LRIANEQNQVLNDVNNKLDAINTMLRVYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
Q5JZY9        90 LKVANEQNQVLNDVNNKLDAINSMLKIYLPKITSMLSDVMKQNYVLSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
Q5PXG4        91 LKIANEQNLMLNNVNAQLNSINATLNTYLPKITSMLNEVMKQNYVLSLQIEFLSKQLQEISDKLDIINLNVLINSTLTEI 170 Bacillus thurin...
WP_003308333  90 LKIANEQNQVLNDVNNKLDAINTMLHIYLPKITSMLSDVMKQNYALSLQIEYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
ADY76642      90 LKIANEQNQVLNDVNNKLNAINTMLHIYLPKITSMLNDVMKQNYALSLQIEYLSKQLQEISDKLDVINVNVLINSTLTEI 169 Bacillus thurin...
Q108N9        90 LKIANEQNQVLNDVNNKLDAINTMLHIYLPKITSMLSDVMKQNYALSLQVEYLSKQLKEISDKLDVINVNVLINSTLTEI 169 Bacillus thurin...
ABR22260      90 LKIANEQNQVLNDVNNKLDAINTMLRVYLPKITSMLSDVMKQNYALSLQIKYLSKQLQEISDKLDIINVNVLINSTLTEI 169 Bacillus thurin...
ABO30520      89 LKIANEQNLMLNNVNAQLNSINSTLNTYLPKITSMLSEVMKQNYVLSLQIEFLSEQLQEISDKLDVINLNVLINSTLTEI 168 Bacillus thurin...
6V1V_A       185 TPAYQRIKYVNEKFDELTS 203
Q4U3F4       170 TPAYQRIKYVNEKFEELAF 188 Bacillus thuringiensis
ABS70723     159 TPAYQRIKYVNEKFEELTF 177 Bacillus thuringiensis
Q58XI2       170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
ACB41771     170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
ABX90027     170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
Q5JZY9       170 TPAYQRMKYVNEKFEELTF 188 Bacillus thuringiensis
Q5PXG4       171 TPAYQRIKYVNDKFDELTS 189 Bacillus thuringiensis
WP_003308333 170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
ADY76642     170 TPAYQRMKYVNEKFEDLTF 188 Bacillus thuringiensis
Q108N9       170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
ABR22260     170 TPAYQRIKYVNEKFEELTF 188 Bacillus thuringiensis
ABO30520     169 TPAYQRIKYVNDKFDELTS 187 Bacillus thuringiensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap