Conserved Protein Domain Family
ApoB100_C

?
pfam12491: ApoB100_C 
Apolipoprotein B100 C terminal
This domain family is found in eukaryotes, and is approximately 60 amino acids in length. There are two conserved sequence motifs: QLS and LIDL. ApoB100 has an essential role in the assembly and secretion of triglyceride-rich lipoproteins and lipids transport.
Statistics
?
PSSM-Id: 403627
View PSSM: pfam12491
Aligned: 15 rows
Threshold Bit Score: 82.4572
Threshold Setting Gi: 637252542
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003270616 4490 QFRYKLQDFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYIMELLKKLQSTTVMN 4545 northern white-cheeked gibbon
XP_014313855 4486 QFKDILQNFSDRLFDYYEKFIAESQILIDLSIQTYHMFLIYITGLLKELQSTTVYD 4541 little brown bat
XP_007654030 4489 QFKVKLQDASDQISRSYETLAAETKRLADLTVENFYAFLKFLTELLQKLRTETAGS 4544 platypus
XP_008116487 4427 QVKEKLQEAYEHLS--YERFITNTKKLIDLVIENYAAFFQDLQQLLHQFEEAAADT 4480 green anole
XP_004175032 4489 QLKEKLREIYGQISQSQEKLISEAKRLIDLTIENYSAFLQYLSELLRWLEQVTAES 4544 zebra finch
EOB06209     4455 QVKAKLQEIYEQLSDSQEKLIGEAKKLIDLTIEKYSALLQYISELLRWLEQVTADS 4510 mallard
XP_003473207 4488 QFTSKLQELSDQFSDYHEKVIALFQGLIDLSIENYHMLLRYITEVLAKLQAATAKg 4543 domestic guinea pig
EHB02362     4643 QFISKLQEFLDQFPDYYEKFIAESQRLIDLAIQSYHVILSYITELLKKLQAATASg 4698 naked mole-rat
XP_023475214 4492 QFIYKLQDFPDQLSDYYEKFIAESQRLIDLSIQIYHVFVKYIAELLKELQLATVND 4547 horse
XP_004745940 4365 QFRYKLQDFSEQLSEYNEKFITESKRLIDLFIQKYHMFLTYITELLKEIQLTTVNN 4420 domestic ferret
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap