Conserved Protein Domain Family
TraW_N

?
pfam12477: TraW_N 
Sex factor F TraW protein N terminal
This domain family is found in bacteria, and is approximately 30 amino acids in length. There is a single completely conserved residue G that may be functionally important. The traW gene of the E. coli K-12 sex factor, F, encodes one of the numerous proteins required for conjugative transfer of this plasmid.
Statistics
?
PSSM-Id: 492653
Aligned: 9 rows
Threshold Bit Score: 42.8819
Created: 16-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013299189   3 RAIAFAAWLALSSEATAKDLGVRGAVFPVT 32  Parvularcula bermudensis
Q6LW87        13 ITLFLLSFFCLPLPTDAKNLGVFGPVFPIG 42  Photobacterium profundum
Q3IUW0         7 ILTALAVVACTAGAAAGKDFGVYGKLFPIA 36  Rhodobacter sphaeroides 2.4.1
WP_025386770   3 IFCCLILLMISMGQVYAKSFGVVGEVFPIT 32  Legionella oakridgensis
WP_012735287   6 RWIAIAAAVLTAAGAHSEDLGVVGPTYPIA 35  Burkholderia glumae
Q2LTZ6        71 FILAVLSSLLLAQAAVCADLGNIGATYPVv 100 Syntrophus aciditrophicus SB
1_pfamImport   1 IAALLIASIL--PAANAASLGSIGPTYPIG 28 
WP_011831711  18 TAVHAAVFLLAAPSATAQQLGVYGNVWEIr 47  Methylibium petroleiphilum
Q93GN1         2 kWRGLTALLIWGQSVAAADLGTWGDLWPVq 31  Salmonella enterica subsp. enterica serovar Typhimurium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap