Conserved Protein Domain Family
SUFU_C

?
pfam12470: SUFU_C 
Suppressor of Fused Gli/Ci N terminal binding domain
This domain family is found in eukaryotes, and is typically between 192 and 219 amino acids in length. The family is found in association with pfam05076. There is a conserved HGRHFT sequence motif. This family is the C terminal domain of the Suppressor of Fused protein (Su(fu)). Su(fu) is a repressor of the Gli and Ci transcription factors of the Hedgehog signalling cascade. It functions by binding these proteins and preventing their translocation to the nucleus. The C terminal domain is only found in eukaryotic Su(fu) proteins; it is not present in bacterial homologs. The C terminal domain binds to the N terminal of Gli/Ci while the N terminal of Su(fu) binds to the C terminal of Gli/Ci. This dual binding mechanism is likely an evolutionary advancement in this signalling cascade which is not present in bacterial homologs.
Statistics
?
PSSM-Id: 403612
View PSSM: pfam12470
Aligned: 15 rows
Threshold Bit Score: 237.368
Threshold Setting Gi: 568253145
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002429835        242 EIIEKGIETEGSNLGGVSAKCSWIEKDFDIECSLheqssii----------akselgGPRISEQ----ESQQIKSELKK- 306 human bo...
XP_011482786        243 ERVDQGIETEGSNLSGVSAKCVWDDLSQPPEDEEdsrsi-------------clgsqPRRLSNK----DTEQIRETLRK- 304 Japanese...
Q9Z0P7              253 ERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEdsrsi-------------clgtqPRRLSGK----DTEQIRETLRR- 314 house mouse
EKC30433            250 DQVEQGIETEGSNLSGVNSRCSWEEPGENGDDYYnedmkdnrtv---derrnsneidRPRISDF----ESEQIKATLQK- 321 Pacific ...
XP_001601038        275 EKVQSGIAREGSNLSGVSAKCWWVQMGDKSTQKYreqrqesdeeddgelepeeeidiKPNIKSErlspCEQDVKMSVEQd 354 jewel wasp
WGS:AAPP:GF17874-PA 251 vNLQDDLEKQGSDLAGVNAEFSFRELKPKKEVKKevdfhals-------ekcaneenNRPLTESlfkrEEPSFPQSMSIs 323 Drosophi...
EDW24939            249 INLQDDLEKQGSDLAGINADFTFKETKP-TIVKQevdfqsls-------ercateenNRPMTESqmkrEEPSFPQSMSLs 320 Drosophi...
XP_001842898        243 RQLEIDLEKEGSDLAGVNADFTFKELPKiaikkei---------------vdpeeeiTKSISSCnieiKKEFN--DGLEh 305 southern...
Q7PYI0              249 RQLELDLEKEGSDLAGVNADFTFKELAKGALTvavkkev-----------ldpdedlSRSISSCniavKEEANEKDTLEq 317 Anophele...
1_pfamImport          1 --VDEGIEADGSNLSGVTANCAWSEnf----------------------------vvNQKSCQNflvtVGDQYHSEFLRy 50 
XP_002429835        307 --------GL----LSSKPGINNsliktedfedfdryvlfflpnvsvrksDIMFQGNFAESTELVHVVHLEGIHLTFNLE 374 human bo...
XP_011482786        305 --------GLefnsKAALPPISSqkqsher-------------aqsrkdsLESESSSAIVPHELVRTRQLESVHLKFNQE 363 Japanese...
Q9Z0P7              315 --------GLeinsKPVLPPINSqrqnglthd----------rapsrkdsLGSDSSTAIIPHELIRTRQLESVHLKFNQE 376 house mouse
EKC30433            322 --------GL------QFPRRDSrefeyd---------------ntrrkqSFDSIGSSEGPTELLRTRTLDFVHLKFNLE 372 Pacific ...
XP_001601038        355 s------nGL---------------------------------------------------------KTLMGLHLTFNLE 371 jewel wasp
WGS:AAPP:GF17874-PA 324 snslhkscPLd--fQPLAPN----------------------------------------------CISLDGIEITLAPN 355 Drosophi...
EDW24939            321 snslhkscPLd--fQPQAPD----------------------------------------------CISLDGIEITLAPT 352 Drosophi...
XP_001842898        306 sg---ssdMVnpfhHSQVPS---------------------------------------------RVSPLNGIELTLAPY 337 southern...
Q7PYI0              318 stgstssdMVnpfdNPNIPS---------------------------------------------RVFPLTGIELTLAPY 352 Anophele...
1_pfamImport         51 nifrfvtiKLliltN-----FYRgr------------------------nSLGLGNSGFETTELLQTKVLENVHLTFNLE 101
XP_002429835        375 SGILLPLALRGRVKHGRHFTFKSVLGDTAITFVASSVTGTFVNSDHPYAAHGPWLQVLIPDDFATEMITDIEMLnQ-NTD 453 human bo...
XP_011482786        364 SGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAFATEEHPYAAQGPWLQILLTEEFVDQMLGDLQEL-N-SRE 441 Japanese...
Q9Z0P7              377 SGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPWLQILLTEEFVEKMLEDLEDL-T-SPE 454 house mouse
EKC30433            373 AGSLLPLALKGRLRHGRHFTFMSALNDTAVTLVSTSVNGSIADENHPFAAHGPWLQVLLTDDFIEEMIVDTEEL-V-HPD 450 Pacific ...
XP_001601038        372 AGTLLPLAIKGRVMHGRHFTFKSILSHAAVTLVPPSVTGTFATKEKPYAVQDPWLQVLLPDELTERMAQEFQVL-N-APE 449 jewel wasp
WGS:AAPP:GF17874-PA 356 VAKYLLLAIKDRIRHGRHFTFKA--QHLALTFVGETVTGCAVSKKEPYGVLGYWVQVLIPEDLVPRMLEAFRGAgLnETC 433 Drosophi...
EDW24939            353 VAKYLLLAIKDRIRHGRHFTFKA--QHLALTLVAETVTGAAVSVHEPYGVLGYWIQVLIPNDLVPRMMDDFRNAnLdENT 430 Drosophi...
XP_001842898        338 AAKFLVLAIKDRIRHGRHFTFKA--QNMAVTFVSESVTGSIVTKDSPYGVLGYWVQILIPNALIPKMIDTFSDLnS-SVD 414 southern...
Q7PYI0              353 AAKFLMLAVRDRIRHGRHFTFKA--QHMAVTFVAESVTGSIVNRQTPYAVLGSWVQILIPNRLVPRMVERFGELsTrSAD 430 Anophele...
1_pfamImport        102 SGSLLPLAIRGRVKHGRHFTFKSACSPIAITFVAESVTGSFVDVDKPYVAHGPWLQLLLNEDSSNQLLEKLQPLiS-HPE 180
XP_002429835        454 EITFPKTFAWPDRKIVITI 472 human body louse
XP_011482786        442 ETKLPREYSWPEKKLKISV 460 Japanese medaka
Q9Z0P7              455 EFKLPKEYSWPEKKLKVSI 473 house mouse
EKC30433            451 EIMCPKTYSWPERRLMITI 469 Pacific oyster
XP_001601038        450 QLQLPKTFTWPEYKLAITI 468 jewel wasp
WGS:AAPP:GF17874-PA 434 EPAQRIELEWPDKNLKLIV 452 Drosophila ananassae
EDW24939            431 ELTQRLQFDWPDKNLRLIL 449 Drosophila persimilis
XP_001842898        415 NLKIPLTYEWPEHNLKFII 433 southern house mosquito
Q7PYI0              431 GLKIPLTYEWPEQNLKFII 449 Anopheles gambiae str. PEST
1_pfamImport        181 QIMLPQTYTLNDKKLSITI 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap