Conserved Protein Domain Family
GDH_N

?
pfam12466: GDH_N 
Glutamate dehydrogenase N terminal
This domain family is found in bacteria, and is approximately 60 amino acids in length. The family is found in association with pfam05088. There is a conserved ALR sequence motif. Glutamate dehydrogenase (GDH) is a homohexameric, mitochondrial enzyme that reversibly catalyzes the oxidative deamination of L-glutamate to 2-oxoglutarate using either NADP(H) or NAD(H) with comparable efficacy.
Statistics
?
PSSM-Id: 372129
View PSSM: pfam12466
Aligned: 3 rows
Threshold Bit Score: 141.808
Threshold Setting Gi: 283473754
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9PBP9      1 MmVSKKSLSTSVKGPAKDPAKQSLVGDVEPRCMVNLESVFAVLREQCPVSMQSDVQRLGAAFYCRMETDEFARRTPEQWA 80   Xylella fastidiosa
Q8P878      1 M-TAKKAASNSSTTSAKPVAERAVPVVATAPQAITLEPVFAALRKRYPAARQSEVQLFAADFYRRMEEDEFPNHPPEQWA 79   Xanthomonas campe...
CBA16257    1 M---AKLIDAAPVAAA----------------GFSLAPVFAALRKRYPAARQDQAQAFAEAFYKRMQEDEFPQHTAQEWA 61   Xanthomonas albil...
Q9PBP9     81 ALVMGMLEFARVRSSG 96   Xylella fastidiosa
Q8P878     80 ALAADMLEFARTRKAG 95   Xanthomonas campestris pv. campestris
CBA16257   62 ALAVSMLEFARKRKPG 77   Xanthomonas albilineans GPE PC73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap