Conserved Protein Domain Family
MMS19_C

?
pfam12460: MMS19_C 
RNAPII transcription regulator C-terminal
MMS19 is required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription. This C-terminal domain, along with the N-terminal, MMS19_N, form part of a silencing complex in fission yeast that contains Dos2, Rik1, Mms19 and Cdc20 (the catalytic subunit of DNA polymerase-epsilon). This complex regulates RNA polymerase II (RNA Pol II) activity in heterochromatin and is required for DNA replication and heterochromatin assembly.
Statistics
?
PSSM-Id: 403605
View PSSM: pfam12460
Aligned: 89 rows
Threshold Bit Score: 169.755
Threshold Setting Gi: 1091794544
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007415512  464 QLFAELPDASPFPTPTTatfk---qpkdYIRVLEALATLCHQPDLFESFLVRILNRIDFACSAGSRsaggeideedhNLY 540  Melampsora la...
EDO37103      412 eniSHLQSDKSHPQ--------------YDQMLNTLSAVCTEEGVVRHVVPIILDHGEYLVTGKDLer--------gVLH 469  starlet sea a...
XP_002588594  519 KLLQVLENNNPNAMDTNqseqvcakhvtNQYVLNTLAAVSTHPTIVRCTIPKLLSHLQALIESCPDq---------aTQE 589  Florida lancelet
XP_023197233  562 lkkEMLSDRRESSELHShh-------avRQRCLSALAAVSVRASVVMESAPILLDVLGSAHADPDRf---------sVDE 625  southern plat...
NP_001334591  520 lkekiLSDECSGAV--------------RRRCVAALASVSSQPSVVQESSPVLLQVLTSAHTGCCGf---------sVEE 576  zebrafish
Q0V9L1        518 QLCANLQTEPMDINLNEsrvvp--erfiRQRCLEALAAVSTHQSILKETVPILLDYIGRVHNGEGEt---------nAEN 586  tropical claw...
XP_015144276  519 RLGEELQSEREEEEEGSrdl-----rslRQRCLQALAAVSTHTSIVRETVPVLLQHLRKVQKGSEAg---------nAQN 584  chicken
XP_008121269  533 evleDINPSH------------------QERYLKALAAVSTHPSIVRETVPVLLEQLQQVQEGKIPs---------dTQF 585  green anole
XP_023350567  410 RLAEELHTGDTELASGEgpsy----qarRLRCLQALSAVSTHASIVRETLPMLLQYLRHVHRG--Kna--------nSNE 475  Tasmanian devil
NP_082428     529 KLAEELHKGESDVARADgptk----csrHFRCLQALSAVSTHPSIVKETLPLLLQHLCQANKGNMVt---------eSSE 595  house mouse
XP_007415512  541 AH--HLLLTLYIVLETKTedksigqsqlVLQAERILLRIFAVFISedemvgkslAVKDqgehevlfgtpddlellvvrer 618  Melampsora la...
EDO37103      470 GKisETLKCLNSIVKGTLqsst---vepNYYTEVVIYRIIDLCTQ---------SALQesp------------------- 518  starlet sea a...
XP_002588594  590 AI--ATLDCVYKVVEKTVind----anvEYFVDTIVLNLMSMALS---------AAVNtsd------------------- 635  Florida lancelet
XP_023197233  626 VV--CACLSLQRIAERVQdge----dtsRCFHDVIVPRLLSLALQ---------AALQndgss---------------gr 675  southern plat...
NP_001334591  577 VI--AVCISLQRIAVHARdne----aigQFFHDIIIPRLLGLTLQ---------AALQskds----------------gh 625  zebrafish
Q0V9L1        587 VV--SICRSLHRVAVQCQlds----ealQFYHEIVLPSLLSLTVQ---------AATQdsgt-----------------s 634  tropical claw...
XP_015144276  585 VI--SACRSLHRVALQCQqda----egcWYYHRAVVPCLLAMAVQ---------AATQesshp---------------lv 634  chicken
XP_008121269  586 VV--SVCQSLQQVALKCQqdp----qsyWFFHQAVVPCLLGLGVQ---------AAMQensh-----------------t 633  green anole
XP_023350567  476 VI--AVCRSLHLVAGQCQqep----escWYFHQTAVPCLLALAVQ---------ASMPdkdlp---------------np 525  Tasmanian devil
NP_082428     596 VV--AVCQSLQQVAEKCQqdp----esyWYFHKTAVPCLFALAVQ---------ASMPekess---------------vl 645  house mouse
XP_007415512  619 vsIRNDTRLVADAGRIVNLMVRQMDSKQQQDFANRLYACYELGQTDALINgafepnspptasmaekrLFRPMSTDAPeSD 698  Melampsora la...
EDO37103      519 dcPMATPEALALVCSIVRQVISHLAVNEAEDVLHIIVSNFIEGKTPLSARae--------------qKFAPLEPSSP-WQ 583  starlet sea a...
XP_002588594  636 enLLHDTSLLEIVAKVLRAVARSLPNSTGKGIVNSTVQAFLQGNLAAISLnt-------------saSFEPLDVSSP-WQ 701  Florida lancelet
XP_023197233  676 rsPLVEEEVLSSMVPVISTAFSRL-QTFAEQTASRAVSLFLDGDVSFLPDnsfp----------prvQLLQQQEDSS-WC 743  southern plat...
NP_001334591  626 isPLTDEAVLSAIVPVISTACAALKPESASRMAAQAVSLFLDGDTSFLPEnaf------------psQIQPLQSQAD-SR 692  zebrafish
Q0V9L1        635 cnVLLRDDVLTAMVPVITAACTHLTPELASKSVSQVVALFLDGDVSLFSEnnl------------psNFQPFQVNGP--T 700  tropical claw...
XP_015144276  635 skALLEEEVLTAMVPVISAATTHLSPELAAQSVSHVVPLFLDGEVSFLPQnsf------------pcSFQPFEDGEClEP 702  chicken
XP_008121269  634 skVLLKEEALSAMVPVISTACIHLSPELASQSVSKVVPLFLDGELSFLPGnsf------------psTFQPFQDGES-PM 700  green anole
XP_023350567  526 gkLLLEEEVLAAMVSVISTASTHLSPELAAQSVALVVPLFLDGDVSFLSEnsf------------psKFLPFQNS----S 589  Tasmanian devil
NP_082428     646 rkVLLEDEVLAALASVIGTATTHLSPELAAQSVTCIVPLFLDGNTSFLPEnsf------------pdQFQPFQDG----S 709  house mouse
XP_007415512  699 KNML---VLYSDALIAIRPDVII--PGELLstTESFPfkyyrhtleMGASTKLLPIKAGLRLLCSTVNRRC--NDFPQFF 771  Melampsora la...
EDO37103      584 QSQLv--TVLMAAVCSARREVRIprQKELV--PRLQVl--------ASGCNHRKTTVAASKCLGGIINKMAqgDDLTADL 651  starlet sea a...
XP_002588594  702 QTQTv--QLLSAIVCSVARNVDIpsISELA--QKLLTl--------SCASDHEPTSLAAAKSLSGVVNKWDqgEQLQTFL 769  Florida lancelet
XP_023197233  744 QTQLv--CLLMACVCSLPRSVALsqEERLL--SELEEl--------SCSCRHPFSYTSAAKCFAGLVNKKPqgPSLDRLI 811  southern plat...
NP_001334591  693 GPSQl-vCLLMACVCSLPRSVEIpdMDRLL--VQLEDl--------SCTSPHLFSYTFASKCIAGLVNKRPagAALNAVL 761  zebrafish
Q0V9L1        701 ELQNhlvSLLMAFVCSLPRNVEIphLRRLL--QHLLSl--------SLSGCSPFAYSSASKCFAGLINKCPqgDLLDDIL 770  tropical claw...
XP_015144276  703 QRRLv--SLLMAFVCSLPRNVVIpqQERLL--RELLAl--------SCSCNCPFTATAASKCFAGLVNKHPagQQLDEIL 770  chicken
XP_008121269  701 AAQRrlvALLMAFVCSLPRNVPIpqQDRLL--CELLAl--------SCSYDCPFTSTVAAKCFAGLVNKHPagTQLDHLL 770  green anole
XP_023350567  590 SEQKrlvALLMAFVCSLPKNVEIpqLDRLM--QELLTl--------SCHHDRLFSCTAAAKCFAGLLNKHPagQQLDEFL 659  Tasmanian devil
NP_082428     710 SGQRrlvALLTAFVCSLPRNVEIpqLNRLM--RELLKq--------SCGHSCPFSSTAATKCFAGLLNKQPpgQQLEEFL 779  house mouse
XP_007415512  772 DEELPSFWKSEIEigpltqhqprilAIEIWIWIIKGLIVRGEQRGYDLLDRLIELWNeKGGSGKEVIRFTGLIV---DEV 848  Melampsora la...
EDO37103      652 HSLKGQLQNHMDGneeq-----rwrAVITWLWLTRALVTRSHPMAQEFVQKVLHLLD-DVSVGRVAADGFYVIVsdcDDV 725  starlet sea a...
XP_002588594  770 QETRDCLEQILSKtedek---arcrAVAVLVWLTKALVIRGHPSGSQFTKTLMALFE-DEAIGRRAAEGFYVILs-dSPD 844  Florida lancelet
XP_023197233  812 QGVIKRVSSELDRpssp----lrtqAFTLLIWVAKALLLRYHPLFSALTDKLFTLLD-DALLGPMAADSFSLLMs-dSAD 885  southern plat...
NP_001334591  762 DRVLKRVSLELEEtsst----hrtqAFTLLIWVAKALLLRYHPLSTALTDKLFSLLS-DSALGSLVADGFCVLMn-dSPD 835  zebrafish
Q0V9L1        771 QVTAQRIDVGLVDeps------rtrAITLLVWVTKALVLRYHPLSGQLTNKMIGLLS-DKQLGPSVANMFSLLVs-dSPD 842  tropical claw...
XP_015144276  771 QLAVNRMEPGLAEgph------rtqALTLLLWVTKALVLRYHPLSSHLTDKLLGLLS-DTELGPTAADGFSLLMa-eSPD 842  chicken
XP_008121269  771 EMAMNKLEQGLNEgph------qsqALTLLLWVCKALLLRYHPLTTQLTDKLLVLLG-DSVLGPKVSDGFVLLMa-dSPD 842  green anole
XP_023350567  660 QKAMEKVETGLSPgpy------rsqAFTLLLWVTKALVLRYHPLSSCLTERLMGLLS-DAELGPAAADGFSLLMa-dCPD 731  Tasmanian devil
NP_082428     780 QLAVGTVEAGLASess------rdqAFTLLLWVTKALVLRYHPLSACLTTRLMGLLS-DPELGCAAADGFSLLMs-dCTD 851  house mouse
XP_007415512  849 -VGSRNFGVVKFLWKQRACSYLLNKLVEAYHRRDNEDKTVYLIGLASLLAHVTPQLILPELSQVIGLLLEGLHLPEDELK 927  Melampsora la...
EDO37103      726 -MNQAMHADIKMMYKQRFFMETLPLLLKGFHDTRPECKYLYLCALSHLLQWIPKQVLLTEIPTLMPMLIQALSRDEPSLL 804  starlet sea a...
XP_002588594  845 vLSKESHANIRLMYKQRFFMENLPALVDGFNQADDGRKQSFLCAVSHLLTFIPRQVLLGALPPLVPLLVQSLLGEDPSLQ 924  Florida lancelet
XP_023197233  886 vLNRGCHADVRIMYRQRFFSENSAKLVQGFNAAPQEKKANYLKALSNIVNKLPKQVQVSELPALLSLLLEALTCPDEGVQ 965  southern plat...
NP_001334591  836 vLNRDCHADVRIMYRQRFFTENSSKLVQGFNSAEQAKKSCYLKALSHIVNNLPREVQLTELPALLPLLLEALSCVDQGVQ 915  zebrafish
Q0V9L1        843 iINKACHADIRIMFRQRFFTENVPKLVQGFNSANRDDKPNYLKALSHVLNALPKQVLMPELPSLLSLLLEALSCPDKVVQ 922  tropical claw...
XP_015144276  843 vLHKGCHADVRIMFRQRFFTDNVPKLVQGFHGAGADVKANYLKSLSHVLNHLPKPVLVTELPTLLSLLLEALSCSDRVVQ 922  chicken
XP_008121269  843 vLGKSCHAEVRLMFRQRFFTECVPQLVQRFHAAVPDMKSNYLKALSHILNHLPKPVLVTELPSLLSLLLEALSCHDRVVQ 922  green anole
XP_023350567  732 vLHRAGHAEIRIMFRQRFFTDSVPALVQGFHAAPQNVKPNYLKGLSHVLNSLPKPVLLPELPTLLSLLLEALSCTDSVVQ 811  Tasmanian devil
NP_082428     852 vLTRAGHADVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDSVVQ 931  house mouse
XP_007415512  928 TNVLKTINELIMneESYEIFEPYLSSLIEGLL 959  Melampsora larici-populina 98AG31
EDO37103      805 LSTLQTLYSLVF--DAPEVISRQVTSLIPNFL 834  starlet sea anemone
XP_002588594  925 VSTLEMFSSLVQ--EAPQVISKNIDALIPQLL 954  Florida lancelet
XP_023197233  966 LSTLSCLQPVLI--NPPQVLVLQLEALVSRLL 995  southern platyfish
NP_001334591  916 LSTLSCLQPVLL--ESPAALNTQLEALFTRLL 945  zebrafish
Q0V9L1        923 LSTLTCLEPLLQ--EAPETLKVHIDGLISKLV 952  tropical clawed frog
XP_015144276  923 LSTLSCLQPLLL--EAPQIMSLHIDTLVTKFL 952  chicken
XP_008121269  923 MSTLHCLQPLLL--DAPHIMSLHIDTLVGKFL 952  green anole
XP_023350567  812 LSTLSCLQPLLL--DAPQVMSLHIDTLVTKFL 841  Tasmanian devil
NP_082428     932 LSTLSCLQPLLL--EAPQIMSLHVDTLVTKFL 961  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap