Conserved Protein Domain Family
DUF3684

?
pfam12449: DUF3684 
Protein of unknown function (DUF3684)
This domain family is found in eukaryotes, and is typically between 1072 and 1090 amino acids in length.
Statistics
?
PSSM-Id: 403595
View PSSM: pfam12449
Aligned: 73 rows
Threshold Bit Score: 993.995
Threshold Setting Gi: 449545439
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPE02298      225 LTFVA-LQKIEFWIDDWKILDLRKDLSASTAVSVPRNLDMRTK--EGLMTVAAIERSSARIDATYMHAVSwkppastsgs 301  Ophiostoma pi...
ESK92923      193 ITFMAtLNSVSVFFDNKCLVKLSKSPGVPRQIEIPNYIQPHSNsdKCSMRITGVKDTPVTIDAQVMRWVY---------- 262  Moniliophthor...
EPT05912      206 ITFMKqLSDVSVYLDDTRISHLRKQPGVPKTVGVPRGLKNTSP--KGIMQVRDIQTTPLHIQADLIRWVY---------- 273  Fomitopsis pi...
XP_002470615  176 ITFMAhLCEINVYLDDQRISRLTKDPGLPKSIGIPKGLKCNSP--RNLMQVKEMHTTPLSIKAELMRWVY---------- 243  Postia placen...
EMD37151      205 ITFMAhLNEVSVYLDDQRLTKLTKDPGVPKSIPLPSGLKSQTP--MSTMKATGIQTKPLHIKAEVIQWVY---------- 272  Gelatoporia s...
XP_007394651  206 ITFMArLSEVSVFFDGRRLARLKKDRGIPRPIGLKKGLKTETI--KGTMKVIGVDVMPLHIKAEVMQWIY---------- 273  Phanerochaete...
EGO00977      203 ITFMAhLSDISVYFDDQRLTRLTKSTGIPKDLGLLKGLKNTSG--LGIMNVKGINSTQMRIKAEVMEAVY---------- 270  Serpula lacry...
EKM80852      198 ITFMThLQEISVYFDNWCLLTLKKAVGIPQLHQLPRVLSLTSP--TKYMSVSNLKEIPVTIQATVMNWIY---------- 265  Agaricus bisp...
EDR11411      200 ITFMThLSQISVYFDDSCLVRLKKSSGIPRDIGIPQFLNGVSP--LRTMAVKSIKSTPLHIQAEVMKWVY---------- 267  Laccaria bico...
XP_003029522  205 ITFMTtLAEISVYLDGKRLVRLTKGNSLPKPSTFPRYMTTRGP--AKIMSAKQLRSTSVSIKAEVMRWVY---------- 272  Schizophyllum...
EPE02298      302 glgtgsiagsgpASSSASnsKSTDTYgisAGDL-PSLKSFFSRF-TSASTKDKRTKAVREEQ-AVQDTVLQNL------T 372  Ophiostoma pi...
ESK92923      263 ------------SSGTQKppPPTAVQpvrSSAQgG-WRSFFSSVi---------VKPTTPLPpPP-PEPPVDL------L 313  Moniliophthor...
EPT05912      274 ------------LAGSEK-----VAPpkpATTVk--SSGFFSSLfSSLSGTQTPQRASTP-ApAP-VVEQIDP------T 326  Fomitopsis pi...
XP_002470615  244 ------------MAGSEKpvSKTLVKaaaAATAg--PSGFFSSLfSTLSGTSAPQRPLTP-SpAANPTEEVDP------T 302  Postia placen...
EMD37151      273 ------------MAGSEKpaPSQPATpqnTER----TTGFFASLfSSFSGSATPQRGPSPFPpTE---PTVDP------T 327  Gelatoporia s...
XP_007394651  274 ------------EAGSSAkqRKRVVVgeqQQARrAVTSGFFSSLfSSFS--STPQRAPSPMLaPESEGVEREAeeqkklL 339  Phanerochaete...
EGO00977      271 ------------SVGTEK--PSITAVvkqSKPSt--QGGFFSSLlSSFTGTTTPQRTATP-LpAP-PAENKNP------T 326  Serpula lacry...
EKM80852      266 ------------TSNTES---RKKLLpkpVKAV---ATSFFSSLfGSLASNSTPQRQSVSLPpVI---PQIDP------L 318  Agaricus bisp...
EDR11411      268 ------------TSGSEK--FRTTAPakpAKIIg--QGSFFSSLfSSLSGGTTIQRTNVA-LpSE-PATVFDA------R 323  Laccaria bico...
XP_003029522  273 ------------TSGTEKppLRPPVVkkeEK-----PQGFFKSLf-SFAAATASTPQITPQQpPPPPPIRKDP------R 328  Schizophyllum...
EPE02298      373 SEGRASIFLRVTTASVKT-NVAANFASELERATKKPPPKTTRMAILTSSYEDAKAskaaaklpspeSGENAAMAVPAAD- 450  Ophiostoma pi...
ESK92923      314 AISPTSVSLSIISADILLqKIDSKLESEIERSTKKQPPRKIRYDLIYTAKGEYDT-----------SKKLDEEQTFATGs 382  Moniliophthor...
EPT05912      327 TVTETSVMLSIFSADVAV-KLDQKLRSELHRSTKKNPPASMTLHLIYTGKDEYDA-----------SRKDDEKQPEKTGs 394  Fomitopsis pi...
XP_002470615  303 TITESSVVLLIFTAGIAV-RLDQKLRSELNRATKKNPPTTMRLELIYTGKDEYDA-----------SRKEDDRQPASTGs 370  Postia placen...
EMD37151      328 SLTESSVVLSIFAVDVVV-QLDQKMRAALLHSTKKNPPTKTRLELIYTGKDEYDA-----------SKKEDEQQPKATGs 395  Gelatoporia s...
XP_007394651  340 TVKELNVTLAVFSAEVEV-RLDERMKKELLRATKKNPPTHMKYELIYTGKEEYDA-----------SKKEDEQSPLGTGs 407  Phanerochaete...
EGO00977      327 EVHETSVTLLIFSADVDV-RLDKKMVTELNRSTKKNPPQQLKYNLIYTAKDEYDA-----------SISEEEKQPFSGGs 394  Serpula lacry...
EKM80852      319 GTSETSIILSVFSADIKV-KLDSKLSSEIHRSTKKRPPSTMKYELIYTAKDKYDA-----------SKQEEAKYPHATGs 386  Agaricus bisp...
EDR11411      324 EINETSVSLTIFSAHIGV-QLEKRVATELYRSTKKNPPTNMKFELIYTGKAEYDS-----------SKEEDKQQQFGTGs 391  Laccaria bico...
XP_003029522  329 KVEETSVNLSIFTMDMDV-TLDRKMTAELYRSMQKNPPKAVKYSLIYTAKDEYDA-----------SKKEDEQVASELGs 396  Schizophyllum...
EPE02298      451 IFASVLPSQKPG--GRIFIGFPTQQTTGAGMHISApSLIPTVEREAIDLNARWVRNWNMELLRVAGILSRLAFINEMSDL 528  Ophiostoma pi...
ESK92923      383 VFQGLRADLEGTgaARVFIGHATAQTTGLGGHMSS-RFIPTVERESIDLMDRSVAIWNRELLFIGGIVSRVVYEKEMHEI 461  Moniliophthor...
EPT05912      395 VFQGLRADIEGSgsARIFIGHATSQTTGIAGHMAA-RFIPTVERESIDLMDRTVAVWNEELLYVGGFLARAGYELEMDQI 473  Fomitopsis pi...
XP_002470615  371 VFQGLRADIEGAgaAKVFIGHSTGQTTGLAGHLAA-RFIPTVERESIDLMDRTVAVWNEELLHIGGFVARAAYELEMDNI 449  Postia placen...
EMD37151      396 IFQGLRADLEGTgsAKVFIGHSTGQTTGLGGHMAA-RFIPTVERESIDLQDRNVAVWNKELLYAGGYLARAAYETEMETI 474  Gelatoporia s...
XP_007394651  408 IFQGLRADIDGTgaARIFIGHSTGQTTGIGGHMSA-RFIPTVERESIDFMDRNVRVWNEELLGVGGYLARTAYEEEMYSI 486  Phanerochaete...
EGO00977      395 IFQGLRADLHGSgsARVFIGHATGQTTGIGGHMAT-RFIPTVERESIDLVDRNVAIWNRELLYVGGFLCRTAYEMELVNI 473  Serpula lacry...
EKM80852      387 VFQGLRADLEGYlsDRRLKGHATAQTTGIGGHMAA-RFIPTVEREAIDFMDRHVAVWNRELLYVGGLLSRAAYQIEIEAV 465  Agaricus bisp...
EDR11411      392 IFQGLRADIDGVgaARVFIGHATAQTTGVGGHVAA-RFIPTVERESIDFMDRNVSLWNKELLYVGGFLARSAYEFELAEV 470  Laccaria bico...
XP_003029522  397 IFQGLRADLDGQgtTKLFIGHATAQTTGLGGHMAS-RFIPTVERETIDLADRNVAVWNRELLHMGGILARAAYEVELGGI 475  Schizophyllum...
EPE02298      529 DTKFRRYVEENra-aaAGTNavknnkvvaiptpEEIAKFVPEALHVLKTYTYGDSTPSAYVSQIVEESFWTTC------- 600  Ophiostoma pi...
ESK92923      462 KRRWEENSTASnpp-----------------smDLQNDLRSKAIHAMKFFTFHPSTPSSDIASLIEAAFFSCT------- 517  Moniliophthor...
EPT05912      474 RQLWAGATGKPp----LAQPd-----------aELVSWLRARALHAMKFFTFHQSTPLAEVSRKMEAAFFLCGe------ 532  Fomitopsis pi...
XP_002470615  450 RQLWTAAAESArgdggTALPd-----------eELQTWLRGRAIHALKFFTFRPSTPSSLVSAKLEAAFFSCA------- 511  Postia placen...
EMD37151      475 RTLWNGAVESKgg--lASEPd-----------aDMKSWLLGRALHAMKFFTFQRSTPSTVVSQLLEEAFFTCGesagm-- 539  Gelatoporia s...
XP_007394651  487 SFLWPKSDLRAp----NGVVe-----------eEAQRKLSARALHAMKFFTFHASTPAAQASALLEEAFFSCVsvsspfs 551  Phanerochaete...
EGO00977      474 RALWEGAASSAat--pDFKPd-----------sELRAWLHNRFLHALKFFTFHPSTPSSDVSRLLEVAFFACS------- 533  Serpula lacry...
EKM80852      466 HKIWEANAEMF-----QGAIl-----------pELQSSLTSRATHALRFFTFHPSTPSAEVSVLLENAFFSSG------- 522  Agaricus bisp...
EDR11411      471 KQLWENAGDLn---------------------dDIRRHLWSRGLHALKFFTFHPSTPSAEVSNVLEAAFFSCS------- 522  Laccaria bico...
XP_003029522  476 RELWQGAGPS---------Ps-----------dDLKTWLTARALHALKFFTFHQSTPSHAVSSLIEAGFFGCS------- 528  Schizophyllum...
EPE02298      601 ------KE-PTLDIFSSRGVMSTTKVRLESEEVSKFVNGIPVVVEQMKDS--PFIQKLHEFGIIQDVTIEDVRSELESKP 671  Ophiostoma pi...
ESK92923      518 ------TIvSKFPIMSSTGIRDIADIRLPDSSFS-FLKQLPVLPHEVLEGarLMVTSLQNRGLIKPIQPEDVWKELRARP 590  Moniliophthor...
EPT05912      533 ------PR-HPFPLISTVGVRDASGVRIPDAAFSEFVKELPLVPEEVLQGarRMVDTLQDRGMVKNIEFMDVLQELRARP 605  Fomitopsis pi...
XP_002470615  512 ------AN-HPFPIISTRGVRSAADVRRPDPVFMEFLKELPVLPGEVTTGaeMIVGALRTRGMIRDIQFVDVLQELRARP 584  Postia placen...
EMD37151      540 --fpfsSS-RPFSVMSTRGIRSAADVRIPDEAFAGFLKQLPVLPPEILSGahQMVDSMRTRDIIKSITFVDVLQELRSRP 616  Gelatoporia s...
XP_007394651  552 fkmgeqST-HPFPVISTVGIRSTSEVRLPNPTFAEFLKQLPVLPAEVIEDakTMIETLRARDMIKEITFTDVLKELRARP 630  Phanerochaete...
EGO00977      534 ------PQ-HPFSILSTAGVRSAFDVRMPDPLFASFLKQLPVLPEGIITEipRMAASLQDRGMLKDITFMDVLGELRSRP 606  Serpula lacry...
EKM80852      523 ------PF-NGLPLISTLGIRNAPQIRLPDPSLT-FLKRLPMVPDELVSe--PMVLSMHSKGVIKAVTFEDVLDELRARP 592  Agaricus bisp...
EDR11411      523 ------SN-NQFSILSTQGVQQSSKVRLPDSTFSSFLKNLPVLPDEVFSGaqSITTSLHNRGLIKNITFDDILNELRSRP 595  Laccaria bico...
XP_003029522  529 ------PA-KNFPLLSTSGVRADCSVRMPHASYAAFLKQLPTVPDAIVDGapAMVGALAARGIIRDVTFDDVLAELAARP 601  Schizophyllum...
EPE02298      672 LDRTQLVHFVKWIASG--ASSRELDPPSVRSLLRVAVASMV-DPEKSEGsvtIIELRGIQNYLSgN-----KVPANLPLP 743  Ophiostoma pi...
ESK92923      591 LTEEELANCLKWWTSL---DRSVIGPAQLAALLDAAVFIAGqLGSANEK---IIPLSTIKTFFNrSrg--lGIPMDGPLP 662  Moniliophthor...
EPT05912      606 LTESEMIACFKWWVGVqnQGEARTLARIRTELLNAAVLCIGeKGSPDER---IIPMSTIHTFLNtRtt--gAIPTDGPLP 680  Fomitopsis pi...
XP_002470615  585 LTEAEMVMCLKWWTGMqgQVDAQKYATIRSELLNAALLFIGeTQSKGGK---VIPMSSIQTFLNtRampgaIVPTDGPLP 661  Postia placen...
EMD37151      617 LAEVELVACIKWWVGVhnKERPRNFQQIHAELVNAAILTLNaPGSSEGT---LVQLSSIRTFLNtRgi-gaHIPTEGPLP 692  Gelatoporia s...
XP_007394651  631 LPEAEMIACFKWWIDLykSGATKQTERARGELLNAAVVIVCsPGGADER---IIPLNTIKSFLNsRv---aYIPLDGPLP 704  Phanerochaete...
EGO00977      607 LSEEEMIACLKWWIGLskQGDNPNLSRIRTEFINAAVLASGrPASPDEK---ILPLSSVQTFINpKnm-gpLIPLDGPLP 682  Serpula lacry...
EKM80852      593 LPEDDMVACIKWWISNynISNAAHLTSVRKQLIDAAVLSIf-PTSGEEK---IIPLHSIKTVLNqRll--ngLPSDGPLP 666  Agaricus bisp...
EDR11411      596 LKEDEMIACLSWWAGVyeKDDSSRLLPIRSQLLDAAILTNGe-AGKEEK---VTPLSHIRTFINpRsl-ggTVPLDGPLP 670  Laccaria bico...
XP_003029522  602 LPEAEMVACMRWWADAskQLDRGRFESVRGQLLGAAVLILGs-GTEGER---ILPLSTIETYATpRt---vILP-EGPLP 673  Schizophyllum...
EPE02298      744 PSTMPFSITNTVPLQHL-VALGWTQLDLVPWLEYLLTARqtL---GSEYNMTEHPPFAAQVLQVLSKNWEN-MSIPHKTV 818  Ophiostoma pi...
ESK92923      663 PHMLPESVSRNLVPARLsSHLRWRDLTMFDWVDHLC-----SgqcPPEYDIRLSPPWAEAVLQAVA-SWASrSQQAELNE 736  Moniliophthor...
EPT05912      681 AHLLPVSVSRHLDPNHLsIAFPWREFTTIDWIRHVTSATg----lDVEHDITKSPQWAERVFQVLARMWPN-MAKGNQEE 755  Fomitopsis pi...
XP_002470615  662 PHLLPVGISKQLDTRQLsSAFAWRELSILEWLQPISDPA--AsglDVEHDFTKSAQWAERVLQVISRAWQH-LSKDVQEQ 738  Postia placen...
EMD37151      693 DHLLPIGISKQFDPQALmTVFSWKELTILDWLKYITDST--NssiDAEHNITLSPVWAERVLQMLARAWQN-LPKASQEE 769  Gelatoporia s...
XP_007394651  705 SYLLPHSISRHFDSQWLkAAFGWDEFHLPEWLRHILDPQ--VrssDAEHDITLSASWAERVLQVFTRAWPS-STKVVQQA 781  Phanerochaete...
EGO00977      683 DHLLPLNVSKHVDSLSL-SSFGWRELSIADWIQYILKPD--VlaaNVDNDITKSPVWAERVLMVILRGWPN-MSNEARNT 758  Serpula lacry...
EKM80852      667 THVLPLSIAKHFSLDDLkRACSWADLTITDWLDHICDPA--VasaNSTYNIESSPHWAEKVLSFVARNWVNgISSINKQH 744  Agaricus bisp...
EDR11411      671 NHLLPVGISKALKLETViTSFPWTELTVIQWLNYISKPA--TgkfHVDYDLSKSAPWAERVLLVLARSWPT-LSSQSKNE 747  Laccaria bico...
XP_003029522  674 PHLLPAEVSKQFEPLVLaSAFGWTELSTVEWLEHLCSNA--VvgkDAAYDLTANPEWAERVLTTLARAWPA-LSTALKGE 750  Schizophyllum...
EPE02298      819 ATNLLKSSTCMPTKMGMKKPGDAFFPTVKLFDDLPVLSp---------SCQNLKDRFLLTLGVRKTVDLDTIFTRLMAqs 889  Ophiostoma pi...
ESK92923      737 IVRLLKTMPCMPTTKGMRRPEEAYFASADIFRDLPVVTllsgaysilnSKERHMEALLTKLQVRKHVELQIIFDRMVK-- 814  Moniliophthor...
EPT05912      756 TVVLLRDKACVPTSAGMKLPQEAYLQSAHIFKDLPIVQmps-----gaPVRGVLERVLTAIGVRKHVDLQIVFNRMIK-- 828  Fomitopsis pi...
XP_002470615  739 IVALVRDKSCVPTTAGLKTPQEAYFQSAHVFRDLPIVHmps-----daPVKGPLEKVLQALGVRKHVDLQIVFNRMIK-- 811  Postia placen...
EMD37151      770 IITLLREKPCVPTSNGMKLPAESYFPSAHLFQDLPLVTlps-----gtVLKGTSEKILQALGVRKHVDLQIVFNRMIK-- 842  Gelatoporia s...
XP_007394651  782 VADLLKNVPCVPTITGMKLPSEVYFQNAHVFPDLPLVKlps-----gaPIKGTLEKVLEALGVRKHVDLQIIFNRMIK-- 854  Phanerochaete...
EGO00977      759 VATSLKDKTCIPTSSGMRLPREAYLSSANIFKDLPIVTlps-----gtTIKLSLEKILVSIGVRKHVDLQVVFDRMIK-- 831  Serpula lacry...
EKM80852      745 VIILLKAKTCIPTSNGMKRPDESYFSSADIFHDLSTVRlps-----gnPVKGSIEKLLQDLEVRKHVELQLIFNRMIK-- 817  Agaricus bisp...
EDR11411      748 VFLLLEDITCIPTSAGMRTPDQSYFPNANIFHDLPVAVlps-----gnAIKGPMEKLLQALAVRNHVDLQIIFNRMIK-- 820  Laccaria bico...
XP_003029522  751 ALALLRDRTCVPTSAGLQKPQQAYFASADIFHDLPVVSlps-----gtAVRGNLAKLLQDVGVRKHVELQLIFDRMVK-- 823  Schizophyllum...
EPE02298      890 vspakaaeQEKgearanktWSHVELIKYLASVRSDIPESDMRKLRESAFCPAE--Agp-lGQESTIPSNKLYRANELFEP 966  Ophiostoma pi...
ESK92923      815 --------TKE--------WTTADLVKYLVSVQETLSSTEMKRLEETVAFTAEgdS------------TKRYSAKQLYVP 866  Moniliophthor...
EPT05912      829 --------TGD--------WTIAELVKYLVAVQSTLTQAEIDRLGATAAFTKEeqA----AGDTTEGRKTRYKASDLYEP 888  Fomitopsis pi...
XP_002470615  812 --------TGD--------WTIAELIKYLVAVQSTLSPLETDRLRMTAAFLKEdeS-----GNSKDNKATRYKASDLYEP 870  Postia placen...
EMD37151      843 --------TGD--------WTIVELIKYLVSVRTMLTSEEFQRLRLTAVFPKEsdA-----ETSDGKKAQRFRASDLYEP 901  Gelatoporia s...
XP_007394651  855 --------TGD--------WSIIDLIKYLIAVQSTLSDDEIERLKLTAAFPKEqrAevqkQPLNEPVKPERYRANQLYEP 918  Phanerochaete...
EGO00977      832 --------TGD--------WTISDLTTYLVAVQSTLTPEEVDRLRATTAFTKEepD----ENSTKTQKRARYRAYDLYEP 891  Serpula lacry...
EKM80852      818 --------TNE--------WTINDLTTYLVSVKSSLKEEEMRRLKLTAAFPREhsA----ALGDVERKPQRLKADQLYEP 877  Agaricus bisp...
EDR11411      821 --------TNE--------WTIADLTKYLVTVKATLTAEEVDRLKVTAAFPKEnsS----ESDSGEVKRVRCQAKDLYEP 880  Laccaria bico...
XP_003029522  824 --------TNQ--------WTIPELVKYFASVQSTLSPEEMRKLVSTKAFFAEgqV------EKEDGKPTRYLAKDLYEP 881  Schizophyllum...
EPE02298      967 SDTVRDLGFPIIQWPdlpNNYfRKSSTEAKFLSELGLRMRPTAQELVHKMTSPDAAMREKARNYFTTNHAmNGYN--MFR 1044 Ophiostoma pi...
ESK92923      867 DDTFRQMGLPVLEWG---IKW-NGRSKEAEFLYRLKLQKQPNADVLIHLCSGDQENVRDLALTYLINNIP-TIYNsnEFD 941  Moniliophthor...
EPT05912      889 SDVIRQLGLPVIDWGq-hPKW-RANSEEAKFLYSLGLQRYPSLPIILGLAGSLDQTVRAAALRYFLDNLL-VKYp--DYD 963  Fomitopsis pi...
XP_002470615  871 LDILRKLGLPIIAWGe-qPRW-RPNSEEAKFLYGLGLRRFPPLPVVIELCTSQDQDIRSTALQYLLSNLA-TRYt--DYD 945  Postia placen...
EMD37151      902 VDAFRQLGLPLIAWGt-tTKW-RNASDEAKFLFDLGLRRAPPLSVILKLAAGSDPNIRSLALKYFLDNSA-KQYl--DYD 976  Gelatoporia s...
XP_007394651  919 SDLFRKLALPVIDWGq--NKW-RPSSEEAKFLFRLGLLRSPPLQTLLGLATSSDEEIRSQALKYLLENHS-TRYn--AYN 992  Phanerochaete...
EGO00977      892 STIFRQLKLPIIDWGh-qVKW-KSSSEEAKFLYRLGLRRSPPLDILIRLCSSPDEELHPIAFKYLLDNMS--KYp--DYD 965  Serpula lacry...
EKM80852      878 LPVFRQLALPVIDWGm-qSKW-RSSSDEAHFLFDLGLRRYPPLQELIQLCMNSDAEIRSTALRYLIDNLR-TKYs--HYN 952  Agaricus bisp...
EDR11411      881 LEIFRQLGLPVIDWGt-qTKW-RSSSDEAKLLFELGLQRYPPLKTVIALCASQDSELHTSALNYLIDNLS-TRYq--EYD 955  Laccaria bico...
XP_003029522  882 LDTFRQLGLPVIDWGt-qVKW-RSNSEEAQFLFKLGLRRFPPLATLVGLCASPDEKIRENAMKYLLAQFD-QRYs-kEYQ 957  Schizophyllum...
EPE02298     1045 -MSTVTSNILPI-----MGeghgagagvtggsndkkgqstEETLVPPSGCYTNVSAAVLGFTILRSDLHAH-ASKFGVAA 1117 Ophiostoma pi...
ESK92923      942 pYKYHNVRFVPAqknsvK------------------------CLCTPNEVYVNPKWATFDLPILNSDKRDI-ATKLKLKD 996  Moniliophthor...
EPT05912      964 pNNFGQIAFIPSvkdqkP------------------------YMAKPSEVYASPEWAALGFATIVPSLRADaLSKLKIRE 1019 Fomitopsis pi...
XP_002470615  946 pGTFQNTAYVPTiknggR------------------------CLAKPFEVYTSSSWAQLGFLVVDPTLPSDaVAKLKIPE 1001 Postia placen...
EMD37151      977 pNTFTDLAFIPArnngvA------------------------TLAKPGEVFTSPMWEPLGFQVVDSTLSAIdLDKLGLRK 1032 Gelatoporia s...
XP_007394651  993 sADFADIAFIPAlrdgrP------------------------CMAKPTEVFARRDWSVMGFPVASPTLSTEdLIKLGIRD 1048 Phanerochaete...
EGO00977      966 pERFNDISFIPAldgsaT------------------------RLGTLKEVFANPDWASFGFLVVQPHLRDGaVSKLGIKD 1021 Serpula lacry...
EKM80852      953 aSDYQDAEFIPAldgtkS------------------------CLGSPRRVFSKSEWSQLGFLVVDPKLQADsA-KLQIKE 1007 Agaricus bisp...
EDR11411      956 pTNFDDIHFIPAlngteM------------------------CLGSPKEVFSNAQWASLGFLIASPKIQRNaV-KLKLKE 1010 Laccaria bico...
XP_003029522  958 pFDFRDIAFIPAmkgtmEKp--------------------IYCLVTPKEVHANVEWIVFGYTVVDPRAPKDiVTKLKIQK 1017 Schizophyllum...
EPE02298     1118 DPPIEQCVNRLLANPPKSHNDAVTVFTYFSTRIGSIYGDTLKKLQNGAFIPVTRKSQSGApvapalnangypdekkmpqr 1197 Ophiostoma pi...
ESK92923      997 HPPSSALVDILTTRPPKDEAQAKAWFQVLAAHVTEFSSGQLKRLSGAPMIPVGSQDK----------------------- 1053 Moniliophthor...
EPT05912     1020 HPPTVALVALLQRSPPSSEAIAQEWFGVLAGRIAEFTQTQLGTLSQMPIVPIAGEK------------------------ 1075 Fomitopsis pi...
XP_002470615 1002 HPPTTALVNLLERSPPNTIPAAREWFSVLASRVTVFTPAQLKKLSTLSFVPAGEVKG----------------------- 1058 Postia placen...
EMD37151     1033 DPPTHLLIALLRGTPPQTEAVARQWFTTLASRVTDFSPSELTMLSQLPFVPIEQGAKVATgq------------------ 1094 Gelatoporia s...
XP_007394651 1049 HPPAMTLVNLLTTAPPQNEEIAKQWFTLMAGRITEFTPAQLQTLSQSLVVPVKSEDK----------------------- 1105 Phanerochaete...
EGO00977     1022 HPPSQMLVTLLEKNAPKSEDTARKWFSTLSGHVTAFSPSQLATLSKLPFVPVKSSKSLPDtss----------------- 1084 Serpula lacry...
EKM80852     1008 QPTASQLVGLLQTKPPDSPEQGEKWFSALSTRVPEFSRSELSRLSETRFIPVYTPAGAI--------------------- 1066 Agaricus bisp...
EDR11411     1011 HPSASQLTTFLQKRRPASKAEAKAWFAVLSGRVNVFSAAHLKSLSQVSFVPVCSENGLE--------------------- 1069 Laccaria bico...
XP_003029522 1018 QPPTGLLVDQLRRNPPKDEEQAKVWFSLLATRIADFTNAELVALSALNMVPVRDKET----------------------- 1074 Schizophyllum...
EPE02298     1198 qsEGTVVEYLWPSACYLGS-SST---YGEIFDFIDFGANANAFLFKCGSKSEPTKIEIARLACSEPARLLSTLQTTERYF 1273 Ophiostoma pi...
ESK92923     1054 ----GGMEYRSPIQCYLGKdTRAa-fHSKLFLFIDFGQVANGFLTACGVKPQPTTDEVAQMLLANPNSFYDLAGGGENFL 1128 Moniliophthor...
EPT05912     1076 -----QPRMMPPSQCYLRGqTEAq-lHSKLFIFVDFGTRANQFLSACGSKQEPSVEEVAKIILDDPRKFYQLAGGRDHYL 1149 Fomitopsis pi...
XP_002470615 1059 ----GNTRMLPPSQCYFSGtSNVq-fHSKLFVFVDFGNQANQFLSACGTKHEPSVEEIAKILLEDPRKFYELADGRDNYL 1133 Postia placen...
EMD37151     1095 ksAILSPHLLPPSQCYFSGdSQAi-fHSKLFVFVDFGTQGNQFLSACGTKHEPSVEEVARILLENPRKFYEIAEGRDNYL 1173 Gelatoporia s...
XP_007394651 1106 -----PLRLMAPRQCYFRNrVETqqlHSKLFTFVDFGLTANQFLSACGTKREPTVEEVAQILLDNPRHFYTMAEGRDSFL 1180 Phanerochaete...
EGO00977     1085 nqRSNTIRWITPNQCYFGGeSKGq-vHSKLFVFVDFGSTANSFLSACGTKHEPSIEEIANILIMDPREFYRLADGRDNYL 1163 Serpula lacry...
EKM80852     1067 ---GPTMRWLLPTQCYLGRqSKEk-fHSKLFIFVDFGQAGNTFLIACGARQEPSVEELAKILLDDPRRFYELAEGPTNFL 1142 Agaricus bisp...
EDR11411     1070 ---GPCVRHLSPTQCYLGGeAKDr-fHSKLFVFVDFGGAANTFLIACGARHEPSVEEIAKKLLADPREFYKLAQGPSHYL 1145 Laccaria bico...
XP_003029522 1075 ----SVLRHLPPTHCFFGGqSKGq-lHSKLFVFVDFGSAANGFLSAVGTKQEPTVEQIAQILLADPYKFYQLSEGPQNFL 1149 Schizophyllum...
EPE02298     1274 NLLRSLAEDLPRLKadRELFRKMKSSPFLLASREIsrqpdqpnqpssgmgglfsssrkksaddddddasfaTDADDEPPI 1353 Ophiostoma pi...
ESK92923     1129 IELKAIAANFRELS--LVNRGRMSKAPVLLAYQRKqlagk------------------------------galeDEEREL 1176 Moniliophthor...
EPT05912     1150 NELRNIAVNHRVFS--GATMARLKRSSVLLGSRRVkkprpaekap----------------seksrpaedfADLEEDDWE 1211 Fomitopsis pi...
XP_002470615 1134 AELRNIAVNNRLIS--TTTITRLKRAPVLLGSRRVkkdksaqk--------------------aspaldshGDLDEDDWD 1191 Postia placen...
EMD37151     1174 TELRNIAINARLIS--SSTLRRMKQAPILLGSRRAprsdshd-----------------------kktrdnMEIDEDEAD 1228 Gelatoporia s...
XP_007394651 1181 AELRNIAVNRRLLS--GGVSARMKRSPILLGIRRVkrekkr---------------------------efdeadEEEDWD 1231 Phanerochaete...
EGO00977     1164 VELRNLAVNRRLIS--QLTYNRMRSSPILLGMKRTrrknsek-----------------------ekgvgvAEWDEDDWE 1218 Serpula lacry...
EKM80852     1143 NEIRNIAVNRKNLS--TVTVSRMKKAPILICSQRKhaeqs---------------------------hpvgGEPDDEEWE 1193 Agaricus bisp...
EDR11411     1146 AELRNIAINSRMIS--AGTIAKMTHSSVLLGSQRKakkip--------------------------rendvDDLDEDEWN 1197 Laccaria bico...
XP_003029522 1150 NELRNIAVNSALVS--STTMARLKRGNVLLGIQRKpkqatr---------------------------eeaeldDEDDWE 1200 Schizophyllum...
EPE02298     1354 KHFQLVAPSQIVILDDYISYRLFKDKLLCAPEEDVLENFYVALGAQMLSSVVREEVTIGSSvPNS---ETQAASLRSFVL 1430 Ophiostoma pi...
ESK92923     1177 MPVGLKRADQIIIANDTNSFQLFGDSLSIAPQDSLLEDFYMSLGSKRLSDLVKEDPKHSEP-EIKn--SKQATEIRQLVL 1253 Moniliophthor...
EPT05912     1212 HEYDLLPASQIVVADDPNAYQLFGNSMFTAPQEDLLEAFYLELGSRLLSSLVKQEHRTTSE-ITA---SAKAAEIRSLIL 1287 Fomitopsis pi...
XP_002470615 1192 LEYDLLSPEQVVIADDTHAYQSFGTSIFTAPQEDLLEAFYLQLGSKLLSSVVREEYRTSAE-VRG---SRKATEIRSLIL 1267 Postia placen...
EMD37151     1229 AQYDLLTPDKVVIVDDPNALQLFGEVIFTAPQEDLLEGFYSQLGSKRLTSLIREEYRTGAE-LRElrvLRKAQDIRSLIL 1307 Gelatoporia s...
XP_007394651 1232 YEYDLLPAAKVVIADDTNAYQLFGDAVFSCPQEDLLEDFYQELGSRRLSSLIKDEHKPATE-IKH---SKKAQETRTLIL 1307 Phanerochaete...
EGO00977     1219 LLYDLRKPGEIIIADDTNAYQLFGDSIFTAPQEDLLEEFYIDLGSKRLSATIREEYKTTSE-IKN---SKIATDVRSLIL 1294 Serpula lacry...
EKM80852     1194 VAYDLNIADRIIIADDTNAHRVFA--------------FYMELGARRLSSLVKEEYLLGGE-IPN---SRRARDTRSLIL 1255 Agaricus bisp...
EDR11411     1198 VVYDLKKPDQIIISDDTHAYQVFGDSLFIAPQEDILEDFYIQLGSRRLSSLVKEEYQTSAE-LAQ---SKISHETRALIL 1273 Laccaria bico...
XP_003029522 1201 LQYDLKRPEEIVVADDSIALQIFGDKLFTAPQEDILEKFYANLGSRRLSSIVKEDFNFGGE-VAN---HKPAQAIKALVL 1276 Schizophyllum...
EPE02298     1431 ERSKIFLF 1438 Ophiostoma piceae UAMH 11346
ESK92923     1254 ERLPLFLH 1261 Moniliophthora roreri MCA 2997
EPT05912     1288 ERLPLFLH 1295 Fomitopsis pinicola FP-58527 SS1
XP_002470615 1268 ERLPLFLH 1275 Postia placenta Mad-698-R
EMD37151     1308 ERLPLFLH 1315 Gelatoporia subvermispora B
XP_007394651 1308 ERLPLFLH 1315 Phanerochaete carnosa HHB-10118-sp
EGO00977     1295 ERLPLFLH 1302 Serpula lacrymans var. lacrymans S7.3
EKM80852     1256 ERLPIFLH 1263 Agaricus bisporus var. burnettii JB137-S8
EDR11411     1274 ERLPLFLH 1281 Laccaria bicolor S238N-H82
XP_003029522 1277 ERLPLFLH 1284 Schizophyllum commune H4-8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap