Conserved Protein Domain Family
Sox_N

?
pfam12444: Sox_N 
Sox developmental protein N terminal
This domain family is found in eukaryotes, and is typically between 69 and 88 amino acids in length. The family is found in association with pfam00505. There are two conserved sequence motifs: YDW and PVR. This family contains Sox8, Sox9 and Sox10 proteins which have structural similarity. Sox proteins are involved in developmental processes.
Statistics
?
PSSM-Id: 403592
View PSSM: pfam12444
Aligned: 22 rows
Threshold Bit Score: 68.1824
Threshold Setting Gi: 1005950101
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003224717  23 PSPALSDEEASSSGSPC-----------PSGSGSD-AEGSGSSshggrpprlgdggAFAKSGDAEMKKEAggvggggggg 90  green anole
XP_015783378  45 GSSSVSSLSSSSSSLSSs----------PASSISP-NVTSLTIs------------SVSKVNGNRKWSNG---------- 91  two-spotted spi...
ACP21268      22 TNSSMSQD-ESDSDAPSs----------PTGSDGH-GSLL------------------AGLSKKLDSED----------- 60  Japanese medaka
XP_005809346  22 TNSSMSQD-ESDSDAPSs----------PTGSDGH-GSLL------------------SGLGKKLDSED----------- 60  southern platyfish
AAH43704      18 TASSMSHVEDSDSDAPPs----------PAGSEGL-G--------------------RAGGGGRGDTAEA---------- 56  house mouse
XP_001373727  21 tTSSMSHVEDSDSDTPLs----------PAGSEGL-GCSSGTGprs--------agGGAALGSKVDPGEV---------- 71  gray short-tail...
Q70W02       115 SAVAVARAAATLLESKSseeenydeslmNTGSSAR-SASPGTNd------------DLSDRDSNPEKDDM---------- 171 vase tunicate
XP_002122233 130 savavaraaaTLLESKSseeenydeslmNTGSSARsA-SPGTNd------------DLSDRDSNPEKDDM---------- 186 vase tunicate
OPJ87426      21 ttSSMSHV-DSDSDSPLs----------PAGSEGL-GCAPAPApr---------ppGSAPLGAKVDAAEV---------- 69  Patagioenas fas...
XP_002932315  21 TASSMSHVSDSDSDSPLs----------PAGSEGR-GSHRp---------------PGISQLSKRDGEET---------- 64  tropical clawed...
XP_003224717  91 EED-KFPVCIREAVSQVLKGYDWTLVPMPVR 120 green anole
XP_015783378  92 EKQvQLASSINDAVTKVLNGYDWTLVTTASR 122 two-spotted spider mite
ACP21268      61 -DE-RFPACIRDAVSQVLKGYDWSLVPMPVR 89  Japanese medaka
XP_005809346  61 -DE-RFPACIRDAVSQVLKGYDWSLVPMPVR 89  southern platyfish
AAH43704      57 ADE-RFPACIRDAVSQVLKGYDWSLVPMPVR 86  house mouse
XP_001373727  72 -DD-RFPACIRDAVSQVLKGYDWSLVPMPVR 100 gray short-tailed opossum
Q70W02       172 SKD------IKDAVSQVLKGYDWTLVPMPVR 196 vase tunicate
XP_002122233 187 SKD------IKDAVSQVLKGYDWTLVPMPVR 211 vase tunicate
OPJ87426      70 -DE-RFPACIRDAVSQVLKGYDWSLVPMPVR 98  Patagioenas fasciata monilis
XP_002932315  65 MDE-RFPACIREAVSQVLKGYDWSLVPMPVR 94  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap