Conserved Protein Domain Family
DUF3675

?
pfam12428: DUF3675 
Protein of unknown function (DUF3675)
This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with pfam00097. There are two completely conserved residues (R and L) that may be functionally important.
Statistics
?
PSSM-Id: 403581
View PSSM: pfam12428
Aligned: 61 rows
Threshold Bit Score: 95.7715
Threshold Setting Gi: 1091748304
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004229398  74 PGYTApPpkkkahLvDnnnnnTAAII-RGSVEADiengrervesdSESEE----REMLVRST-------QYYECSQAADR 141 tomato
Q9LS14       105 PGYTA-Prql-fhYtG-----ISMNF-GSDWGIE-----------GLDLRnpyfLTWGDADD-------DHDLYSFHSPT 158 thale cress
XP_015169110  67 PDYTA-Papl---fgR-----FTMNT-VGNWDIS-----------MGGVDyhhfAALVSTDDnfv--dyESDEYTTFYPR 123 potato
XP_015638861 106 PNYTA-Pakl-fqHgR-----NSIFF-RTPGYIQa-------------------QVMQNTDRsaaa--stsYDPELPNPK 156 Japanese rice
AQK88241      99 PNYTA-Sskl-fqRgR-----NTFFF-SAPGYIQa-------------------RPMQNADHsat-stgYGHD-QTPDPT 149 Zea mays
KQK09233     110 PNYSA-Plkl-frIgR-----NSIIFsRTAGETSgn----------lNANhgqeNVLHTADHavg---tssFVSEGSNPK 169 stiff brome
XP_015635067 110 PNYTA-Plkl-frHgR-----NLISF-RRSGERSdn----------iDTDrsqeHFAQTSDQaag---tssFDSQNSSPK 168 Japanese rice
EFH52999     110 PDYTA-Pppl-leLgH-----VPLHF-RGNWGIS-----------QReh---rfITVVPADStfi-----dqQYPLSSTT 162 Arabidopsis lyr...
XP_009388797 113 PGYTA-Lpkl-fhYgR-----APMNF-RGSWDVS-----------SQDLHdpqiLTVVPSgvi----esNYYDQLVSRLR 169 wild Malaysian ...
XP_018675101  40 PGYTT-Lpkl-ydYgS-----TPMNF-S--WEIS-----------AQDFRdtqfITMFPSDHgaidsavGYRDHSRTS-- 96  wild Malaysian ...
XP_004229398 142 SASCCRTIALIFTILLMMRHLLEVMNGGAKNYPFTLPTLLIIKSTGILLPMYIILMLI 199 tomato
Q9LS14       159 SLICCRLIALLFVLLLFLRHSLPVLLGGVDDFSITLLMLPLVRTLGILLIAYVFFKSF 216 thale cress
XP_015169110 124 SLIWCRIVAITFVLLLMLRTMLPIIFGVAGDNSVSLVMLSVLKAIGMVLAIYVLVKAF 181 potato
XP_015638861 157 GVIYCRIVALTLMVLLLLHDAISVFLGDHDAYTVAMITLLMLRTAGIVIPVYIILLSL 214 Japanese rice
AQK88241     150 GVLCCRIIAIALMVLLVFRDAVSVFLGDQDAYTVAVVTLLMLRTAAIVIPVYIILVAV 207 Zea mays
KQK09233     170 GATYCRVIAIALMVLLVFRDAISLVLGGPEVYSMVLITLLMLRTAGIVIPIYIILISV 227 stiff brome
XP_015635067 169 GVFYCRVVAISLMALLVLRDAISLILGDPEVYSIALFTLLMIRTAGIVIPIYIILVSV 226 Japanese rice
EFH52999     163 SFICCRSLVLIFMALLILRHTLPLVLSGSNLHVFPLFTLLFLRVLGIMLPIYVVTKAV 220 Arabidopsis lyrata subsp. lyrata
XP_009388797 170 SAICCRSVTIIFMILLVLRHTLPLIISGAEQYSFTLFSLLVLRTAGILVPIFFIAGTl 227 wild Malaysian banana
XP_018675101  97 NTFCCRSITVIFMVLLVLRHALPLLISDDDEYSFTLFSMLVLKTAGVILPIFLVLGIi 154 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap