Conserved Protein Domain Family
STIMATE

?
pfam12400: STIMATE 
STIMATE family
STIMATE is a ER-resident multi-transmembrane protein that serves as a positive regulator of Ca(2+) influx in vertebrates. It interacts with ER-resident Ca2+ sensor protein STIM1 to promote STIM1 conformational switch. This entry also includes budding yeast YPL162C.
Statistics
?
PSSM-Id: 403562
View PSSM: pfam12400
Aligned: 110 rows
Threshold Bit Score: 96.7898
Threshold Setting Gi: 124471302
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCH60636                      115 CDWYFLNLLLDTTIGIPILWFLLNCIHYIFQYLN-IKNIESGNYfpsledydtnlimhhtiagnnigmlgddnciitast 193 Tetrapisispora blattae CBS 6284...
XP_002904052                   85 CAWYFLNFLSDCTLGMIVSLAFLRLQQELAFSMNwVNIQESGEY------------------------------------ 128 Phytophthora infestans T30-4...
EEC46631                      136 CAWYGMSYLIDTTLGLVLAIFFLGVLDKLASERDwVHLKHSGVYsgp--------------------------------- 182 Phaeodactylum tricornutum CCAP 1055/1...
EED94644                       97 CAWYAINYVIDTTLGLVITIFFLNALEKVANDRDwTSLKNSGVYvgr--------------------------------- 143 Thalassiosira pseudonana CCMP1335...
CBJ27007                       93 CAMYFVNFSLDIAIGTFMIWCFVRVQELTAVRCGiDSLKVTGDY------------------------------------ 136 Ectocarpus siliculosus...
3_pfamImport                    1 CALYFVNFTLDTTFGVVLNYFLLSGLAFLALRLSwSALQTTGDY------------------------------------ 44 
EEY69815                       93 CALYFVNFTLDTTLGVFLNYVLLSAVVLLALRFSwSSLKTPGDY------------------------------------ 136 Phytophthora infestans T30-4...
WGS:AAGF:cds.TTHERM_00056080A 135 CNYYFVTVVIDTSCGVFLACFLLLQLDNLLKRKG-CENLRTGNYyketkvfkkrt------------------------- 188 Tetrahymena thermophila SB210...
Q23H86                         72 CNWYFVTVLFDTTLGVFICFIILSIFEKLFDRYH-LVKFKTGNY------------------------------------ 114 Tetrahymena thermophila SB210...
XP_009536481                   82 CAFYFMNVVIDTTLGVYIAYLLLQLFTLVATRQQwTSLRCHGYY------------------------------------ 125 Phytophthora sojae...
CCH60636                      194 nnilhSRr--------------------------Pm---------FKAFLIQLSIYSSGLLLMKSVVFLILNYFEEfSYW 238 Tetrapisispora blattae CBS 6284...
XP_002904052                  129 -----GN---------------------------Pp--------sYRVWAMQLIAWLVIIVISKAIVVSVMIAAATpLGF 168 Phytophthora infestans T30-4...
EEC46631                      183 -------------------------------------------dgVLHWISQCLAWLVILTVVKVIIYIFMLAGGSwLAW 219 Phaeodactylum tricornutum CCAP 1055/1...
EED94644                      144 -------------------------------------------egIIHWMHQMVAWIIILTLVKVVICVFMWITAApLAW 180 Thalassiosira pseudonana CCMP1335...
CBJ27007                      137 -----GT---------------------------Pp--------lFSVYRTQLLAYTVILVICKAVTTAIVIAMDEvLSS 176 Ectocarpus siliculosus...
3_pfamImport                   45 -----GM---------------------------Pv--------qVRTWLLQVLSWIVVIFTCKMMIAAVILAFQQpLGA 84 
EEY69815                      137 -----GT---------------------------Pv--------rVRTWILQVLSWILVIFTCKFLIALLIVAFQKpLGA 176 Phytophthora infestans T30-4...
WGS:AAGF:cds.TTHERM_00056080A 189 -----------------------ivdenqnimniPmedvnyieidYLTWLIQLAIWLTLTFISKMILFFVQALLKYpLGL 245 Tetrahymena thermophila SB210...
Q23H86                        115 -----FKviipdngsgqktkkksredesnihllkPivk-----isYCVWLSQLIIWNLIVVISKFFLYGLQSGISPyLQP 184 Tetrahymena thermophila SB210...
XP_009536481                  126 -----GS---------------------------Pp--------sWRVWWMQLLQWCAILTIMKVFVGGVLYAFSTpLGW 165 Phytophthora sojae...
CCH60636                      239 FANLMLGWSDSWPNFQVFLVMFICPIVLNCFQILCIDSIIK 279 Tetrapisispora blattae CBS 6284
XP_002904052                  169 LGELLFHSLRGYPFAELVLVMIVCPSFLNVVQFWIQDSFLK 209 Phytophthora infestans T30-4
EEC46631                      220 IGGVLFAPLQGNIRFELLFVMIFFPGILNVIYFWIADGYLK 260 Phaeodactylum tricornutum CCAP 1055/1
EED94644                      181 IGAILFEPLQSNIRFELLFVMIFFPGFLNIIYFWITDSYLK 221 Thalassiosira pseudonana CCMP1335
CBJ27007                      177 LAKALFSPVSAYPELELTLVMIICPWILNALQFWILDNVLM 217 Ectocarpus siliculosus
3_pfamImport                   85 LAVLLFKPLEKYPDVELVLVMIACPCLMNAVQFWIQDSFLK 125
EEY69815                      177 FAVLLFKPLADHPDVELAIVMIACPCLMNALQFWVQDNFLK 217 Phytophthora infestans T30-4
WGS:AAGF:cds.TTHERM_00056080A 246 ASYFLLYWLNSMPVVKLVFVMIIIPTIMNGMQFWIQDNVLK 286 Tetrahymena thermophila SB210
Q23H86                        185 IISWMFSFLESFVKLKLIIVMVIVPAILNAIQFWIQDNFLK 225 Tetrahymena thermophila SB210
XP_009536481                  166 VGSLLFYPVHNHPKIELLIVMIGCPLVMNMVQFWIQDSFLM 206 Phytophthora sojae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap