Conserved Protein Domain Family
Peptidase_M73

?
pfam12389: Peptidase_M73 
Camelysin metallo-endopeptidase
Statistics
?
PSSM-Id: 372085
View PSSM: pfam12389
Aligned: 11 rows
Threshold Bit Score: 283.103
Threshold Setting Gi: 81745732
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8ENF4                   2 KLKKKLGMGVATAVLGLGLIGGGTFAYFSDTAQATGEFTAGELSLSAE----PSVVIDVNNLKPGDTMIRSFELLNDGTL 77  Ocean...
Q81TI4                   2 TLKKKLGMGIASAVLGAALVGGGTFAFFSDKEVSNNTFATGTLDLALN----PSTVVNVSNLKPGDTVEKEFKLENKGTL 77  Bacil...
Q81TI3                   2 SLKKKLGMGVASAALGLSLIGGGTFAYFSDKEVSNNTFAAGTLDLTLD----PKTLVDIKDLKPGDSVKKEFLLKNSGSL 77  Bacil...
WP_014642212             2 SFFKKVSAGVVTASLGLSLMGGGTYAYFSDTETTNNTFGMGTLDVSVD----PEVIVDVNDLKPGDTVLKEFKLGNEGTL 77  Halob...
Q8ESH2                   2 NLKKKIGAGVLSATLGLTLIGGGTYAYFNDQEVTTNSFAAGTLDLSVD----PTAIIQIDNLKPGDTMLREFSLSNAGSL 77  Ocean...
Q8ES42                   2 GIKKQLGMGVATAVLGLSLIGGGTFAYFSDSTETSNTFAAGTLDLTAE----PTEIINVENMAPGDSMVRDFELQNSGTL 77  Ocean...
Q8ERK0                   2 DIKKKLGTGIASAVLGLTLISGGTYAYFSDSVTTNNTFAAGTIDLGVD----PTEIISVDNIKPGDVITRDFELQNNGTL 77  Ocean...
PRJNA212797:N288_03660   2 gFKKKVGMGIASAALGMSLVGGGTFAYFSDTAEANGKFTAGTLDLNAN----PTTIIDVKNIKPGDTMLRSFNLLNDGSL 77  Bacil...
WP_014822810             2 SIKKKLAMGIATGALAVSMIGGGTYAYFNDVDVNNSVFAAGTLDINVKgnnaDNAIINVTNIKPGDTMTREFNLNNTGSL 81  Solib...
Q9KB07                   2 TIKRKVGMAVITAAVGVSLLGGGTYAWFNDVETIESSFAAGTIDLGVD----PTIVFDVNNLKPGDHMTRKFTITNNGTL 77  Bacil...
Q816G5                   2 SLKQKVGMGIITASLGLSLTFGGVFAYFSDSETSSNSFQAGTLDLSIN----PSVIVNVKDLKPGDFIERNFKLDNKGTL 77  Bacil...
Q8ENF4                  78 DISKVDISTSYVV----DDVGGNNS-EDFGKHIRVNFLENVDKtgfdpifwdydHNDVISYTTLYDLKNMTPDAVENlNK 152 Ocean...
Q81TI4                  78 DIKKVLLKTDYNV----EDVKKDNK-DDFGKHIKVTFLKNVDK-----------HETIVKETALDKLKGDTLTAVNN-DL 140 Bacil...
Q81TI3                  78 TIKDVKLATKYTV----KDVKGDNAgEDFGKHVKVKFLWNWDK-----------QSEPVYETTLADLQKTDPDLLAQ-DI 141 Bacil...
WP_014642212            78 DIKSISLLTDYNV----IDAEGDNNgSDLGDHIRVNFLWNWDK-----------ESEPVFQTTLSELQGMDPDTVAK-DV 141 Halob...
Q8ESH2                  78 KIENVFLETNYSV----LDSNNDNT-DDFGKHVKVNFLWNWDQ-----------ESEPVFETTLYELKEMDPDVVKR-DI 140 Ocean...
Q8ES42                  78 DINTVYLETNYTV----EDAQGDNS-EDFGEHIEVEFLYNVNN-----------LDEVIYQTTLAELQDMTPEAINE-HI 140 Ocean...
Q8ERK0                  78 DIEKVLLDTDYTV----TDVNTDNS-EDFGDHIRVEFLYNADK-----------LDEVIYETTLAELKEMTPEAVNE-NV 140 Ocean...
PRJNA212797:N288_03660  78 DIASIKLKTEYSV----TDAKNNNA-DDFGKHIRVNFLFNQDK-----------LDTPIYSTTLSELKTMSPDVIEG-NI 140 Bacil...
WP_014822810            82 DVAKVLLTSKYNV----TDTNNNNAgADLGEHIKVQFLVNNDK-----------KTEVIHETTLKALSS--TDVVDR-DV 143 Solib...
Q9KB07                  78 DIHEVLMFTQTEVykngKKLKSSDEgADFATQLRVDFLSNEGK-----------IIPEISGKTLAELESQSGNIADN-YR 145 Bacil...
Q816G5                  78 DIAKVALETSYEV----TDAKQNNDgEDLGDHIIVKFLVNDGQpsn-----psdDHEIVWETKLSQLKTMKPEDVAT--- 145 Bacil...
Q8ENF4                 153 WWTIFKGEAs--gLEAGTSDEMLVSFEFVENGAD--------QNEYQKDSLNLTWTFTGHQTEGEA 208 Oceanobacillus ihey...
Q81TI4                 141 AAWFWDEKG----ISAGKSDKFKVKFEFVDNKKD--------QNEFQGDKLQLTWTFDAQQGDGET 194 Bacillus anthracis
Q81TI3                 142 FAPEWGEKGg---LEAGTEDYLWVQFEFVDDGKD--------QNIFQGDSLNLEWTFNANQEAGEE 196 Bacillus anthracis
WP_014642212           142 FDPLWEQRGg---LDVGDEDTLWVQFEFVDNGED--------QNEFQGDDLNLTWQFHANQTDGED 196 Halobacillus haloph...
Q8ESH2                 141 WDPLWEQHGg---LEAEETHDFWVEFEFVDDGED--------QNDYQGDSLELEWIFNATQSSGQd 195 Oceanobacillus ihey...
Q8ES42                 141 FYPAIGNEG----LAAGDSHDLVVQFNFKDSGED--------QNQFQGDALNLEWTFIATQGEGED 194 Oceanobacillus ihey...
Q8ERK0                 141 FYPLLGEQG----LPVDSIDDLVVEFQFVDNGED--------QNQFQGDSLELSWTFTALQTEGEE 194 Oceanobacillus ihey...
PRJNA212797:N288_03660 141 FSGWLAERGg--kLAAKTSDKLWVQYEFVDNKQD--------QNQFQGDSLQLNWTFEAKQGKGEA 196 Bacillus infantis N...
WP_014822810           144 LGWLFGGENd--gLKAGTSDKLTVKFEFVDNTKD--------QNVFQGDSLQLEWTFDAKQTGPEK 199 Solibacillus silves...
Q9KB07                 146 RWLIWESGKk--dLPVGHTDRLKMKITFVPTDERkegsrefvQNKYQGLTLKVTHELEATQKPGQa 209 Bacillus halodurans
Q816G5                 146 ---SLERHNlidgIKSGETDYLHVLFSFEDNDRD--------QNKFQGDSLQLNWTFHAEQTAGVE 200 Bacillus cereus ATC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap