Conserved Protein Domain Family
Peptidase_C71

?
pfam12386: Peptidase_C71 
Pseudomurein endo-isopeptidase Pei
This peptidase has the catalytic triad C-H-D at the C-terminal end, a triad similar to that in thiol proteases and animal transglutaminases. It catalyzes the in vitro lysis of M. marburgensis cells under reducing conditions and exhibits characteristics of metal-activated peptidases.
Statistics
?
PSSM-Id: 403551
View PSSM: pfam12386
Aligned: 2 rows
Threshold Bit Score: 281.541
Threshold Setting Gi: 75093091
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q77WJ4 157 PPVPEEVREMRRVLGEFKTATQLYTLVSRRCKYKFYYNDQTPNREALKKMVTDGINCTDACQLFKPVIEGLGYSVRIEHV 236 Methanobacterium phag...
Q7LYX0 142 SLKGHWTTKVIEKIGTFHDATSLYERVKKTCKYKYYYNDQVPNHVAVMRMTTSGINCTDACQLFSKVLEEMGYEVKIEHV 221 Methanothermobacter p...
Q77WJ4 237 KVRCNDNKWYGHYFLRVAGKELASvslpserWTVWDYVSATKTGRPLGAPCCSRGIQHLGWGIVSPKHD 305 Methanobacterium phage psiM2
Q7LYX0 222 RVKCNDGKWYGHYLLRVGGFELKD-------GTIWDYVSATKTGRPLGVPCCTAGFQHLGWGIVGPVYD 283 Methanothermobacter phage psiM100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap