Conserved Protein Domain Family
Peptidase_A2B

?
pfam12384: Peptidase_A2B 
Ty3 transposon peptidase
Ty3 is a gypsy-type, retrovirus-like, element found in the budding yeast. The Ty3 aspartyl protease is required for processing of the viral polyprotein into its mature species.
Statistics
?
PSSM-Id: 152819
View PSSM: pfam12384
Aligned: 2 rows
Threshold Bit Score: 363.961
Threshold Setting Gi: 146291076
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q875I4    9 VLADTELESKDHKKLSITSRPIVHYIAIPEMDKTAEKHIKIKNTKIKTLFDSGSPTSFIRRDTVNLLNLPTHDTPPLRFR 88   Saccharomyces parad...
Q7LHG5  286 VLTDLELESKDQQTLFIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETPPLRFR 365  Saccharomyces cerev...
Q875I4   89 GFISTESTTTSEAVTLDLTVDNLQINVAAYVLDKMDYQLLIGNPILRRYPKLLYTILNTKQCTSAQKPKAYHSENVNYVK 168  Saccharomyces parad...
Q7LHG5  366 GFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHTVLNTRESPDSLKPKTYRSETVNNVR 445  Saccharomyces cerev...
Q875I4  169 AKSAGNRGNSRNKTPSF 185  Saccharomyces paradoxus
Q7LHG5  446 TYSAGNRGNPRNIKLSF 462  Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap