Conserved Protein Domain Family
DUF3646

?
pfam12362: DUF3646 
DNA polymerase III gamma and tau subunits C terminal
This domain family is found in bacteria, and is approximately 120 amino acids in length. The family is found in association with pfam00004. The proteins in this family are frequently annotated as the gamma and tau subunits of DNA polymerase III, however there is little accompanying literature to back this up.
Statistics
?
PSSM-Id: 403542
View PSSM: pfam12362
Aligned: 74 rows
Threshold Bit Score: 88.7781
Threshold Setting Gi: 504559099
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014746201           511 LDRWREIIDLLRRHREIRIVPELRAAAHVaeITVTAaeRRLVLAFEPGTDGGLATKLQDLLSRIDDTPWQVlaagalndp 590 Tistr...
Q1GV06                 443 alTIAQIHRLLESTGHHQLARQVYDDLRI--LELEP--GRLVYAPVSALDGDFARRLGEALFGQTGSRWQV--------- 509 Sphin...
Q2NBW3                 393 PSDFASLVDRVEQAGHGFAASIMRLQLRV--IECEE--RRLVFSRASSYTEEIAPQLREALLAATGQRWQL--------- 459 Eryth...
CCA92980               491 aPRWEALVDDVEHMGELSVANTMRMQVRV--VELGA--GLLRYSQPPGFSEDIAGLIRGALSKATGERWQV--------- 557 Novos...
Q2G8M2                 446 sVDWESLVEQVEHVSPL-VGSTMRLAVRL--VDLKP--GLLRYQLAPGLPGDPAPDIRRALNHVTGEAWIV--------- 511 Novos...
AVZ42123               511 PPDFKSLTEMLFDNGHALLGHSLEDYGRL--IEYNP--PRLLLENHSRISGETRQELSLALKNLTKQAWQV--------- 577 Zymom...
PRJNA213647:NX02_04970 473 PADFTALVRMLGDGGKLQLQQQVHDYMGL--VRFAP--PELVLKPSRPVLPDFVRQLAEALKATTGAVWKV--------- 539 Sphin...
WP_015457491           429 PASFGALVELVNGQRPL-LGQQLHDFVGL--VRYAP--PELALRPNRPLPADFIRDLTTLLRNLFAEPWKV--------- 494 Sphin...
TriplettUF:B488_00570  454 VSSVEEILDLCEKNNDFKIKTLIQEFLRV--VRLKP--GQLEVYLAEGAPSAFLHQLAIKLKDWTGMQWTI--------- 520 Liber...
Q0C591                 437 IESFADMIAIMVAAREVGLQVDTERFVRP--SHFEP--GKLACALAPGAPQGLLGRLKIFLETYSDLDWSV--------- 503 Hypho...
WP_014746201           591 A-LTAAArATPTLVQYDEMRNRRMLALARRHPMVEAVFAAFPGATLEAV 638 Tistrella mobilis
Q1GV06                 510 R-EGTGE-GRPSLAQMKAAQRADNEARIRELPVVKAALAAFPDARLVEg 556 Sphingopyxis alaskensis
Q2NBW3                 460 E-ERDWVdAPPSLMEQAEAREEEKKARIDGHPLVAATKTAFPDAEIIpe 507 Erythrobacter litoralis HTCC2594
CCA92980               558 E-KVEGQ-GAPTIVELAETQRAAEGEAMRNAPLVAATIAAFPGAELIQd 604 Novosphingobium sp. PP1Y
Q2G8M2                 512 E-RAEGV-AQPSLEEVKAAKAVAADAAMKEDPLVKAALEAFPGAVIIDE 558 Novosphingobium aromaticivorans DSM ...
AVZ42123               578 EfLQDRK-GQPSFREAEIAQKEARQKAILNTPIVQAVLKTFPDAEWVQs 625 Zymomonas mobilis subsp. mobilis ZM4...
PRJNA213647:NX02_04970 540 S-LGEGQ-AEPTLLDQERMRETAARDAILAMPLVRATIEAFPEAELIhp 586 Sphingomonas sanxanigenens DSM 19645...
WP_015457491           495 E-ISDGP-AEPSLLDQQKSAENAARDAILATPVVRAAFEAFADAEyegy 541 Sphingomonas sp. MM-1
TriplettUF:B488_00570  521 N-LASK--EENSVKKVTETSKDIIFKNMQKDPDVLAAVECFPGAKVSDI 566 Liberibacter crescens BT-1
Q0C591                 504 E-EADTD-TE-SVRERERREKAERIESAKQDPRVAAALALIPGAIILDV 549 Hyphomonas neptunium ATCC 15444
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap