Conserved Protein Domain Family
DBP

?
pfam12361: DBP 
Duffy-antigen binding protein
This family of proteins is found in eukaryotes. Proteins in this family are typically between 449 and 1061 amino acids in length. The family is found in association with pfam05424. There are two conserved sequence motifs: NKNGG and QKHDF. This family is part of the Duffy-antigen binding protein of Plasmodium spp. This protein is an antigen on these parasites which enable them to invade erythrocytes.
Statistics
?
PSSM-Id: 403541
View PSSM: pfam12361
Aligned: 3 rows
Threshold Bit Score: 159.612
Threshold Setting Gi: 156081789
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002260978  627 GGKDSGPStpashalagENGEVHNGTDTEPKEDGEKADPQKNIEVKGKQDTDDRSQGSLGPHTDERASLGETHMEKDTET 706  Plasmodium kn...
XP_001608387  546 AEKVPGDS---------THGNVNSGQDSSTTGKAVTGDGQNGNQTPAESDVQRSDIAESVSAKNVDPQKSVSKRSDDTAS 616  malaria paras...
CAQ39068      628 GGKDSGPStsashalagENGEVHNGTDTEPKEDGEKADPQKDIEVKGKQDTDDRSQGSLGPHTDERATLGETHMEKDTET 707  Plasmodium kn...
XP_002260978  707 TGGSTLTPEQNVSVASD--------------------------------------------------------------- 723  Plasmodium kn...
XP_001608387  617 VTGIAEAGKENLGASNSrpsestveanspgddtvnsasipvvsgenplvtpynglrhskdnsdsdgpaesmanpdsnskg 696  malaria paras...
CAQ39068      708 AGGSTLTPEQNVSVASD--------------------------------------------------------------- 724  Plasmodium kn...
XP_002260978      --------------------------------------------------------------------------------      Plasmodium kn...
XP_001608387  697 etgkgqdndmakatkdssnssdgtssatgdttdavdreinkgvpedrdktvgskdgggednsankdaatvvgedrirens 776  malaria paras...
CAQ39068          --------------------------------------------------------------------------------      Plasmodium kn...
XP_002260978  724 --------------NGNVPGSGNKQNEGATALSGAESLESSESVHKTIDNTTHGLENKNGGNEKDFQKHDFMN 782  Plasmodium knowlesi ...
XP_001608387  777 aggstndrskndteKNGASTPDSKQSEDATALSKTESLESTESGDRTTNDTTNSLENKNGGKEKDLQKHDFKS 849  malaria parasite P. ...
CAQ39068      725 --------------NGNVPGSGNKQNEGATALSGAESLKSNESVHKTIDNTTHGLENKNGGNEKDFQKHDFMN 783  Plasmodium knowlesi ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap