Conserved Protein Domain Family
Pax7

?
pfam12360: Pax7 
Paired box protein 7
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam00046, pfam00292. Pax7 belongs to a family of genes that encode paired-box-containing transcription factors involved in the control of developmental processes. Pax7 has a distinct role in the specification of myogenic satellite cells.
Statistics
?
PSSM-Id: 403540
View PSSM: pfam12360
Aligned: 11 rows
Threshold Bit Score: 28.6702
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGW14105     164 NPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPaIGNGLSPQ 208 Chinese hamster
XP_023144313 362 SADSSSAYGLSSNRHSFSSYSDTFMSPSASSNHMNP-VGNGLSPQ 405 clown anemonefish
CAG06402     388 QAEGGSPYCLASGRHTFSGYTDGFVGPGGPANPMNPtLGNGLSPQ 432 spotted green pufferfish
XP_013120650 324 QGEGGSAYCLASGRHSFSGYSDSFVSPGAPTNPMNPsIGNGLSPQ 368 Nile tilapia
AAH76069     350 AQEGSSAYCLSSGRHGFSGYSDGYVAAPGHANPVNPsISNGLPSQ 394 zebrafish
CAG07684     308 SQDGNSAYCLSSGRHSFSGYSDNFVAPTGHANAVNPtIGNSLSPQ 352 spotted green pufferfish
XP_014327934 350 SQDGGSGYCLSSGRHNFSGYSDSFVPPTGHGNTVNPsISNAISPQ 394 southern platyfish
XP_023193295 355 NVDSGPAYALSSNCNGFSSYSDPFLSSAAQSNAINS----GLSQQ 395 southern platyfish
XP_010170126 277 AADTGSAYG---ARHSFSSYSDSFMNAAAPANHMNP-VSNGLSPQ 317 chuck-will's-widow
XP_025757694 332 SPDGSTAYGLATNRHGFSSYTDTFMNSGTPSNHVNP-VSNGLSPQ 375 Nile tilapia
1_pfamImport   1 STDSSGAYGLASNRHSFSSYSDSFMSSAAPGNHVNP-VSNGLSPQ 44 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap