Conserved Protein Domain Family
DUF3638

?
pfam12340: DUF3638 
Protein of unknown function (DUF3638)
This domain family is found in eukaryotes, and is approximately 230 amino acids in length. There are two conserved sequence motifs: LLE and NMG.
Statistics
?
PSSM-Id: 403526
View PSSM: pfam12340
Aligned: 123 rows
Threshold Bit Score: 200.005
Threshold Setting Gi: 163778656
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007288259 2009 HVGWNPLDHPDWLLLELENNILIRPEQAQIATEMISPSSGSNSIMQLNMGLGKSSVIVPIVAATLADGNKLSRVVVLKSL 2088 Marssonina br...
XP_003844816 2040 HTNWEALEFPDWLLIEIDGNHLLRKEQVQVALATMNPDSGQNSVLQLLMGKGKTSCILPMVAAMLATQTDLVRIVVPRAL 2119 Leptosphaeria...
EFQ90317     2022 HGNWNALEYPDWLLLEIDGDILLREEQVNVALATVSPQSGGNSVLQLLMGKGKTSCILPMVAALLANGKDLARVVVPRAL 2101 Pyrenophora t...
EPE04337     2122 HTNWHPREHPDWLLMEIDANMLIREEQVTVAQAMIEPASQSNSVFQLNMGKGKTSVILPMVLAVLADGNQLARMIVPKSL 2201 Ophiostoma pi...
XP_014173265 1910 HLNWSPAEQTDWLLFEIDSDLLIRTEQVEVARAIIAPASGKNSVLQLNMGKGKTSCIVPMAIASLANGKQLARLVVPKAL 1989 Grosmannia cl...
Q0TXD7       1993 HENWSPLEWPDWLLLEVDSDILIRQEQVDVAHAIIAPKLRENTVLQLNMGKGKTSCIVPMAMAVIGDGNQLSRLIVPKPL 2072 Parastagonosp...
CCU82053      401 HTNWEPSQNPDWLLLEIDSNILIRPGQVDVANATIYPESAKNSVLQMNMGQGKTSCIMPMAAATLADGNNLMRVIVTHAL 480  Blumeria gram...
CAK45810     1968 SEGWDTARSPEWLLLEIENNITIRIQQAEVAQRMICPDQPGNAVSQLNMGEGKTTVITPMVALNLANGSTVPRIIVLKPL 2047 Aspergillus n...
CAP85819     1958 YEGWDPLIYPTWLLLEIENNITIRKRQAEVALRMIEPEDGENAVLQLNMGEGKTSVITPMVATILADGRDILRIIVLKPL 2037 Penicillium r...
EKG17364     1984 RLGWKALDYPDWLLIELENNITIRHLQALVAKEMMYPGSDSNSVLQLNMGEGKSSTIVPMVTAALANGKQIARLIVLKPL 2063 Macrophomina ...
XP_007288259 2089 ATQMRQLLQNKLGGMINRRVYYLPISRSLKL---NEEKATQIRKIYEECLNDGGVLLAQPEHILSFELLGLDHALSd-vG 2164 Marssonina br...
XP_003844816 2120 LLQSAQVLQAKLGGLANRDILHIPFSRKTPT---DRKLMQLYEKMQAQMMNRCGVMLALPEHILSFKLSGLQQLCDnrlE 2196 Leptosphaeria...
EFQ90317     2102 LLQSAQAMQAKLGGLVDRELIHLPFSRKTPL---TESLVNLYGKIHTRLRDHRGVVIALPEHILSFKLSGLQQLCDehlK 2178 Pyrenophora t...
EPE04337     2202 ILPTAQVIQTRLGGLVGRQVRHLTFSRRLISadnTQDLLSSYVATHMSLVASRGMLIAAPEHILAFKLCGLQCLADgktD 2281 Ophiostoma pi...
XP_014173265 1990 LLPTAQMLQARLGGLVGRELRHVPFSRRIAAganVQSVLEIFQEHHNDLMRRRGVLLAAPEHILAFKLSGLQCLADgknA 2069 Grosmannia cl...
Q0TXD7       2073 LLPTAQMIQSRLGGLVGREIRHIPFSRRTNT---NPQTLQLYRHLHREMLEGQGVVLIAPESPLSYKLSGLQHLASsnmD 2149 Parastagonosp...
CCU82053      481 LIQTTQLLQTRLGGLVGREIRHVPFSRKLSS---ISGISKKFREQLQYIQTSAGILIAQPDHILSFKLSGDQAILDgkfL 557  Blumeria gram...
CAK45810     2048 LRQSLTLLTQVLGRILNRPIYHVPFSRDTPL---DKKMLKSLRKMYEQCQKYRGVLIALPEHILSFRLVGLDLIERtp-- 2122 Aspergillus n...
CAP85819     2038 LRQSDGLLSQRLGGLIQRRIYHIPFSRHTQL---TSSTVGQLKAIYRQCRRDRSILIALPEQILSFRLIGLDAAERsp-- 2112 Penicillium r...
EKG17364     2064 LNQTQTLLSQRLGGLVDRPIYHVPFSRQTRL---GNTGIQDLRGVYEECMREGGILVALPEHILSFRLMGREMLDQln-- 2138 Macrophomina ...
XP_007288259 2165 tiettgsgvrfvegnpVGFAMIKTQKWL-LEVSRDILDESDELLSVRFELIYTMGSQRPTEYSPHRWQIVQHVLGIFAKT 2243 Marssonina br...
XP_003844816 2197 ----------------QASAMIKIQDWL-DQHARDVLDECDVSLAIKTQLIYPSGTQSTVDGHPMRWQVAQILLHLVKDH 2259 Leptosphaeria...
EFQ90317     2179 ----------------AASMMIELQRWL-DKHTRDILDECDVSLAIRTQLIYPSGTQMTVDGHPMRWQVTQAVLQLVKDF 2241 Pyrenophora t...
EPE04337     2282 ----------------LGMEMVSFQTELeQTLCRDVLDESDFTLAVRTQLVYPSGDLTAIDGAPYRWQLVQQLLALVQDH 2345 Ophiostoma pi...
XP_014173265 2070 ----------------IARDMIDFQQKLaDEMCRDILDESDFTLAVRTQLVYPSGSLSAVDAAPHRWKMAQMLLAIVEDN 2133 Grosmannia cl...
Q0TXD7       2150 ----------------TAREMIEFQTYL-NSICRDVLDESDVSLAIKTQLIYPSGKQTTVDGHPHRWQVAQSLLSLVKDH 2212 Parastagonosp...
CCU82053      558 ----------------EAGEMIEVQNFV-AKNCRDVIDECDEILSVRNQLIYPSGTHKPIDGNPNRWEIIENLLEQVSFH 620  Blumeria gram...
CAK45810     2123 ---------------kLAQKVINLETWL-QDNCRNLIDESDEVLDPKFQLVYAIGSQQSLDGHSDRWRIVQSLLSLVEQQ 2186 Aspergillus n...
CAP85819     2113 ---------------dIFAPLVALEHWL-QIHCRDVIDESDEVMDTKFQMVYTMGTQQSLDGLSGRWETTQHLLRLVSTQ 2176 Penicillium r...
EKG17364     2139 ---------------eEAQSMVSTEYWL-QKTCRDVLDESDEILKSQFQLIYSLGTQQLMDGQPDRWLITQSVLEILATQ 2202 Macrophomina ...
XP_007288259 2244 AIHLA 2248 Marssonina brunnea f. sp. 'multigermtubi' MB_m1
XP_003844816 2260 VLAVQ 2264 Leptosphaeria maculans JN3
EFQ90317     2242 SSTVQ 2246 Pyrenophora teres f. teres 0-1
EPE04337     2346 AVAIA 2350 Ophiostoma piceae UAMH 11346
XP_014173265 2134 LPRLC 2138 Grosmannia clavigera kw1407
Q0TXD7       2213 LPELE 2217 Parastagonospora nodorum SN15
CCU82053      621 LKTIE 625  Blumeria graminis f. sp. hordei DH14
CAK45810     2187 ATELH 2191 Aspergillus niger
CAP85819     2177 AKCLQ 2181 Penicillium rubens Wisconsin 54-1255
EKG17364     2203 ARNLC 2207 Macrophomina phaseolina MS6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap