Conserved Protein Domain Family
SBF2

?
pfam12335: SBF2 
Myotubularin protein
This domain family is found in eukaryotes, and is approximately 220 amino acids in length. The family is found in association with pfam02141, pfam03456, pfam03455. This family is the middle region of SBF2, a member of the myotubularin family. Myotubularin-related proteins have been suggested to work in phosphoinositide-mediated signalling events that may also convey control of myelination. Mutations of SBF2 are implicated in Charcot-Marie-Tooth disease.
Statistics
?
PSSM-Id: 403522
View PSSM: pfam12335
Aligned: 27 rows
Threshold Bit Score: 267.237
Threshold Setting Gi: 195995677
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002434049  533 VASQD-SV------------------------------------------VSNSARRLEVLCNCINHVFDNKISDARKAM 569  black-legged ...
ESO05166      548 QVEKA-QL------------------------------------------VSTNARRLEVLRNCITFIFENKISDARKII 584  Helobdella ro...
EKC40086      424 LVDRQ-RI------------------------------------------VDNNARRLEVLRNCINFVFDNKISDARIIF 460  Pacific oyster
EEN59651       86 NRRDKfSG------------------------------------------LNSSARRLEVMRNCINYIFDNKIQEAKKSF 123  Florida lancelet
XP_002107707  573 AL---------------------------------------------------MLKRLEVLRKCVSNIFNNRIIEAKKMF 601  Trichoplax ad...
CAP33099      510 HVEYHaNQ------------------------------------------FETYAHRIEALRNCIGDIFDSKASFASKSL 547  Caenorhabditi...
XP_011256263  563 IHDTR-HL------------------------------------------VSNSARRLEVLRNCINCIFENKISDARKTF 599  Florida carpe...
EEB09953      552 ISDNR-PG------------------------------------------ISDSARRLEVLKNCINCIFENKISDARKTF 588  human body louse
4_pfamImport    7 VVDSRqQL------------------------------------------VSNSARRLEVLKNCINCIFENKISDARKSL 44  
XP_016839646  522 INTET-VQaiideglaksnlkarlsllrpipprivpmgphisvvhdtrhlVSNSARRLEVLRSCINCIFENKISDARKTF 600  jewel wasp
XP_002434049  570 PAVLRALKSKAARLALTHELQHHVTGNKAVLEHQQFDLVVRLMNCAL-QDDSALDEHGVAAGILPLSHAFCRKLCTGVMQ 648  black-legged ...
ESO05166      585 PAVLKVLKTKVARLLLVEELGFHVKSNRSLLEHQQFEMVVRLLNSALqQNDSVMDENGVATAILPLAMSFCRKLFTGVIQ 664  Helobdella ro...
EKC40086      461 PAVLRALKSRVARLALTQELSYHIRSNRAVLEHQQFDLVVKLLNCCL-QNDSSMDENGVAAAILPLATTFYRRLCTGIIQ 539  Pacific oyster
EEN59651      124 PAVLRGLKSKVTRLALCDELSLHMQQNRVVLENHQFDMVVRLINCAL-QDCSSMDEHGVAAGLLPLVCAFCRKLAPGVMQ 202  Florida lancelet
XP_002107707  602 SAVLSLLTSVQYRIALVEEFESYCLHSRVVLTFDQFDMVVRLINQAL-QEDDANDRNGVAAMILPFSASFCRKLSDNVHQ 680  Trichoplax ad...
CAP33099      548 DAVRSSMRFAPLRIELCRLLNQR-STSHFVLADKQFDDIALLMNAAL-QTECEEDKDGVVRTLMYLSSVYSRKLAQGIQQ 625  Caenorhabditi...
XP_011256263  600 PAVLRALKSKAARLALCMELSQHVVGNKAMLEHQQFDLVVRLMNCAL-QDDSSMDEHGVAAALLPLATAFCRKLCTGVIQ 678  Florida carpe...
EEB09953      589 PAVGRALKSKAARLALCSELSQHVVGNKAMLEHQQFDLVVRLMNCAL-QDDSAMDEHGVAAALLPLSTAFCRKLCTGVIQ 667  human body louse
4_pfamImport   45 PAVLRALKCRVTRLALCTELDNHVIGNKAMLEHQQFDLVVRLMNCAL-QDVSPLDEFGVASSLLPLATAFCRKLCTGVIQ 123 
XP_016839646  601 PAVLRALKSRAARLALCMELSQHVVGNKAMLEHQQFDLVVRLMNCAL-QDNSSMDEHGVAAALLPLAAAFCRKLCTGVIQ 679  jewel wasp
XP_002434049  649 FAYTCIQDHVVWGQLQFWEAAFYQDVQRDIRSLYLPHTASPQHGGHQPNhqqpnnapgkqktpplspreskdstsswsri 728  black-legged ...
ESO05166      665 FAYTCVQDHPVWSSHQFWEAAFYQDVQQQISNDTTLRRNDSKRWSTFSL------------------------------- 713  Helobdella ro...
EKC40086      540 FAYTCVQEHAVWQNMQFWEAAFYLDVQKQIQQLYAPHFEENHVGDKRDSfqsspthknsel------------------n 601  Pacific oyster
EEN59651      203 FAYTLVQDHPVWANLQFWEASFYTDVQKHIKELYHQPDRNGKVPSSPGM------------------------------- 251  Florida lancelet
XP_002107707  681 FAYTCVWDHPVWDNPRFWERTFYLTCQKHVMNLYENSLIKKANKNA---------------------------------- 726  Trichoplax ad...
CAP33099      626 YMYTVLQEHKVWKNQRFWTSCFYYEVHEMLFSEMLKKDRK---------------------------------------- 665  Caenorhabditi...
XP_011256263  679 FAYTCIQEHPVWQNQQFWEDAFYLDVQKDIKRLYLPGDNSPPRLINDGIlspispr------------------------ 734  Florida carpe...
EEB09953      668 FAYTCIQEHPVWQNQQFWESAFYQDVQRDIKALYLPRMEINSlppsspr------------------------------- 716  human body louse
4_pfamImport  124 FAYTCIQEHAVWQNQQFWEGAFYQDVQKDIKALYAQTSNMEFRIANQPVsdlglkm------------------------ 179 
XP_016839646  680 FAYTCIQEHAVWQNQQFWEDAFYLDVQKDIKRLYLPGENSLSRL-NDGLlsptspr------------------------ 734  jewel wasp
XP_002434049  729 dapkanfdlcnRRPAILSKAPEPSALEIAAEQMRIQQngSLSKEELEELASREESTVYSQAIHFANRM 796  black-legged tick
ESO05166      714 -----------NPPNNAAHQRSIAALEIAAEQMRLWP--NLSEEEKSEMIKNEESTVYSQAIHYANRM 768  Helobdella robusta
EKC40086      602 vskncngqsvtQEKRSSYRAREMGALEIAAEQLRTWP--TLSEEKKAEMISNEESTVYSQAIHYANRM 667  Pacific oyster
EEN59651      252 -----------RRRVEVNRSLEKSALDIAAEQLRLWP--HRSKDDQQELVNNEESTVYSQAIHYANRM 306  Florida lancelet
XP_002107707  727 -----------IEAKNDNKVEDVTAVETV----------ETAINTDTENGKPKAETTFGTT------L 767  Trichoplax adhaerens
CAP33099      666 -----------LTESLWCHTLRPCAMEMI----------DTDDTDQEELVRQENEMIQAQAKHFLNLI 712  Caenorhabditis briggsae
XP_011256263  735 ----dgkefpyRDRYSIYQAQEPSALEIAADQMRIWP--SIDPEKQKELVNSEESTMYSQAIHYANRM 796  Florida carpenter ant
EEB09953      717 -------dsrefpfRNYSRIQEPSALEIAAEQMRLWN--AYTPEKQQELVCSEESTLYSQAIHYANRM 775  human body louse
4_pfamImport  180 ----ptvyfryPKASQGVKGQEPSALEIAAEQMRICS--NINQEKIAELAGSEESTVYSQAIHYANRM 241 
XP_016839646  735 -----dnkdlfRDRTLVYRGQEASALEIAAEQMRIAS--SVSPEKQRELIASEESTLYSQAIHYANRM 795  jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap