Conserved Protein Domain Family
rOmpB

?
pfam12334: rOmpB 
Rickettsia outer membrane protein B
This domain family is found in bacteria, and is approximately 220 amino acids in length. The family is found in association with pfam03797. This family is the middle region of one of the outer membrane proteins of Rickettsia which is involved in adhesion to eukaryotic cells for uptake.
Statistics
?
PSSM-Id: 372053
View PSSM: pfam12334
Aligned: 2 rows
Threshold Bit Score: 322.708
Threshold Setting Gi: 6685725
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
LANL:MCE_07010  705 INFGSKGAHADTILNVGEGVNLYATNITTTDANVGSFVFNAGGTNIVSGTVGGQQGNKFNTVALDNGTTVKFLGNATFNG 784  Rickettsia ...
Q53020          705 IHFATKAANADSILNVGKGVNLYANNITTNDANVGSLHFRSGGTSIVSGTVGGQQGHKLNNLILDNGTTVKFLGDTTFNG 784  Rickettsia ...
LANL:MCE_07010  785 ETTIAANSTLQIGGNYTADCVASADGTGIVEFVNTGPITVTLNKQAVPVNNLKHITVSGPGNVVVNEIGNAVNYHGVATD 864  Rickettsia ...
Q53020          785 GTKIEGKSILQISNNYTTDHVESADNTGTLEFVNTDPITVTLNKQGAYFGVLKQVIISGPGNIVFNEIGNVGIVHGIAAN 864  Rickettsia ...
LANL:MCE_07010  865 TIAFENSSLGAALFLPSGVPFNdagnaiPLTIKSTVGNETATGFDVPKVIVLGVDSVIADGQV 927  Rickettsia amblyommatis str....
Q53020          865 SISFENASLGTSLFLPSGTPLD------VLTIKSTVGNGTVDNFNAPIVVVSGIDSMINNGQI 921  Rickettsia prowazekii str. M...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap