Conserved Protein Domain Family
EOS1

?
pfam12326: EOS1 
N-glycosylation protein
This family is not required for survival of S.cerevisiae, but its deletion leads to heightened sensitivity to oxidative stress. It appears to be involved in N-glycosylation, and resides in the endoplasmic reticulum.
Statistics
?
PSSM-Id: 403517
View PSSM: pfam12326
Aligned: 29 rows
Threshold Bit Score: 147.878
Threshold Setting Gi: 597991085
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBQ70888      777 LEFVVACLWSMSTAYHALSFTTLLLRRWLLYYSILPSLIRLVALQAICWPLVRITIHVFGAD---QPLGAWVVIGTTTAL 853  Sporisorium r...
XP_002174483   59 wrlsTTSLWTAVSAHLSFVLTNNFMLKWLIHYSLAPTIIRLISLNMITVSFVSLSVRYITKGdynYLLHAWIAISCFQTF 138  Schizosacchar...
Q8TFH6         59 wlpLTSALWTLVSAYLSFVLANGFLLKWLIHYSIGPTIIRLFSLNVINFSFLSLSVSFITHGdnaYLLPAWIAISCFQTA 138  Schizosacchar...
KDE07215      389 LDWFLAGMWALACAYFSHSLARGLLRRWLVYYSLLPTIVRVFSLQAICWPLTLTTHRVLSFD---QPVAAWLVCASTAAF 465  Microbotryum ...
XP_001731316  191 IEYVACSLWSICTAFHALSLMTMLLRRWLIYYTLVPSLIRLITFQAICWSLVRAVLLLFGPA---QPVASWIIVSTFTSF 267  Malassezia gl...
CCF51612      795 lDFAVAGLWSMSTAYHALSFTTLLLRRWLLYYSILPSLIRLVALQAICWPLVRLTVHVFGPD---QPLGAWVVIGTTTAL 871  Ustilago hordei
GAC98921      747 lDFAVACLWSMSTAYHALSFTTLLLRRWLLYYSILPSLIRLVALQAICWPLVRITVHVFGAD---QPLGAWVVIGTTTAL 823  Pseudozyma hu...
CCA68344      279 LDYMAAAAWSLLTAYQVLAFTTGLLNRWRHYYPIASTLIRLLALQAICWPATFYTLRFLQYDgveRPLACWAVIGTTTCI 358  Serendipita i...
XP_007332231  296 IDYFVASLWALLTAHQCLSLTTGLLTRWRHYYPPLSTLVRLLALQGICWPATQLTVNIFEVSk--RPAVVWAVIGTTTCT 373  Agaricus bisp...
XP_002496296   93 SEYLLCSLWCIVSLYLSYSILDSLMVRWIVKYSTLAAIVRMFAMSLIIITLELMLLASLSPNg-dYYLHTWILISCVLTG 171  Zygosaccharom...
CBQ70888      854 SDVVSRWVTSNIADAplddeldeeeeqqeaenealgylsdsrfvkspvrpnaaerlmhadqspwsaaggqtlvgdsdwdp 933  Sporisorium r...
XP_002174483  139 AYIVQDWITSPItrtvl--------------------------------------------------------------- 155  Schizosacchar...
Q8TFH6        139 AYIVQDWITSPIirtlp--------------------------------------------------------------- 155  Schizosacchar...
KDE07215      466 SNVIQIWVTSNIVerkdqrghqrwqllsyv-------------------------------------------------- 495  Microbotryum ...
XP_001731316  268 FEIFARWITSNITDVddtqstdgllsdmnetgasdaegmlhseqeimydsyqprarhaarshryqkyrnqslrvira--- 344  Malassezia gl...
CCF51612      872 SDVVSRWVTSNIADAplddeldeeeqeeaeealgylsdsrfvksprvsaterlfradshphaasggqsligdsdwdprsg 951  Ustilago hordei
GAC98921      824 SDVVSRWVTSNIADAplddeldeeeedddeaddvlgylsdsrfvkspprqsaadrmlradqhpwssaggqslvgdsdwdp 903  Pseudozyma hu...
CCA68344      359 TRSIQLWVTSNIddwhrdsvstqysahtvasialgf-------------------------------------------- 394  Serendipita i...
XP_007332231  374 SRSIQMWVVSNLptksassqglstdarerekr------------------------------------------------ 405  Agaricus bisp...
XP_002496296  172 AYIWQSYITSNLNY------------------------------------------------------------------ 185  Zygosaccharom...
CBQ70888      934 rsgdesdaaaasvfasererqrqqrrggqgtrfwraviggpsfaassrrrktstrsssaaaaakathgdrsrvsgagtet 1013 Sporisorium r...
XP_002174483      --------------------------------------------------------------------------------      Schizosacchar...
Q8TFH6            --------------------------------------------------------------------------------      Schizosacchar...
KDE07215          --------------------------------------------------------------------------------      Microbotryum ...
XP_001731316      --------------------------------------------------------------------------------      Malassezia gl...
CCF51612      952 desdaaaatffanererqrkqrrggqgtrfwravig---------------------------------gpsfasssrgr 998  Ustilago hordei
GAC98921      904 rsgdesdaaaasffasererrrrrrrggqgtrfwraviggpsfaatsrr------rknddgtgmrtfvgdrsrqsggtgt 977  Pseudozyma hu...
CCA68344          --------------------------------------------------------------------------------      Serendipita i...
XP_007332231      --------------------------------------------------------------------------------      Agaricus bisp...
XP_002496296      --------------------------------------------------------------------------------      Zygosaccharom...
CBQ70888     1014 emeaesdwpgyttdgtvlgggrgdtppprfaapwnqqglrrrlgaipahvsspasatppslaatrtgvlgrgpvlpplpp 1093 Sporisorium r...
XP_002174483      --------------------------------------------------------------------------------      Schizosacchar...
Q8TFH6            --------------------------------------------------------------------------------      Schizosacchar...
KDE07215          --------------------------------------------------------------------------------      Microbotryum ...
XP_001731316  345 ---------------------------ltgaptevtpsdsdsdtfskpesgfsssvqedmnalspvvdmdhwhrrliarr 397  Malassezia gl...
CCF51612      999 kkvenagggvtetemegesdwpgygtdgtvvggaarsrlglqndglrrrwpastsppsvrggggvleakktelppfpskp 1078 Ustilago hordei
GAC98921      978 etemeadsdwpgyttdrtvlggsgtppsrsgsgprwdqqglrrrlpphvnpaarvstspedrtatetgmfgrrpvlppfp 1057 Pseudozyma hu...
CCA68344      395 -----------------------------------------------------------------gekkvlggteteseg 409  Serendipita i...
XP_007332231  406 ----------------------------------------------------------------------rgveaetnrs 415  Agaricus bisp...
XP_002496296      --------------------------------------------------------------------------------      Zygosaccharom...
CBQ70888     1094 srassyrqgHTRFVYKDGA------WTRERTSSLRNFHWEVAVWRNVVPIAVLSYLSMWILI 1149 Sporisorium reilianum SRZ2
XP_002174483  156 ----ydatnDKPDKQSASSecsqpcNKRTRHRHRHNIDLLELAVFAVVPVGIASFFTMLVLL 213  Schizosaccharomyces japonicus y...
Q8TFH6        156 ----frsssSSSS------------------NYRHNLDFLEITVFAVVPVGIASFFTMVMLI 195  Schizosaccharomyces pombe 972h-
KDE07215      496 ----------------vqavvgppvrsekfrkgERALSWKRVLWGTMVPFAVLGWITTVALL 541  Microbotryum lychnidis-dioicae ...
XP_001731316  398 nrkrqhrsrHKRSKQKSRMsaffqnYRAARIHSRRVFHWNVAIWRNVVPIGILGYLTLWVLL 459  Malassezia globosa CBS 7966
CCF51612     1079 styrqgssrHTRYVYKDGA------WVRERTSSRRTFHWEVAVWRNVLPIAVLSYLSMWILV 1134 Ustilago hordei
GAC98921     1058 fkasmyrqgHTRYVYRDGA------WIRERTSSRRNFHWEVAVWRNVVPIAVLSYLSMWILI 1113 Pseudozyma hubeiensis SY62
CCA68344      410 rsgkrsngrHIK-------------------NNSRKWDWNEVVWKCAFPAGVCYFFMAWSLL 452  Serendipita indica DSM 11827
XP_007332231  416 ktlrvgntyWKKW---------------NRWRRKRRWDWREVSIRCVLPAGVLYFIMawase 462  Agaricus bisporus var. burnetti...
XP_002496296  186 ---------------GVRMdeekprRNYLKFSKKRTIDLYNITVFCVVPVGLASFITMIGLL 232  Zygosaccharomyces rouxii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap