Conserved Protein Domain Family
TryThrA_C

?
pfam12319: TryThrA_C 
Tryptophan-Threonine-rich plasmodium antigen C terminal
This protein is found in eukaryotes. Proteins in this family are typically between 254 to 536 amino acids in length. This family is the C terminal of a surface antigen of malarial Plasmodium species. It is currently being targeted for use as part of a subunit vaccine against Plasmodium falciparum, the main species involved in causing human malaria.
Statistics
?
PSSM-Id: 403513
View PSSM: pfam12319
Aligned: 46 rows
Threshold Bit Score: 155.55
Threshold Setting Gi: 74879914
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001612666  100 AWDHWLTVLEPEWVTFSNFIEQKKKRWIQKKEEDWSIWIKDMEHKWVNYKKKKDRKYLSKYRDGTLNCSEREWNVKMKRE 179  malaria paras...
XP_001612616   60 EWHEWMDEVQMDWKEFNSSLESEKNKWFGKKEKEMMELIKSIEDKWLDFNENMHEVLNYAILKISLMWSFSEWQKWINKD 139  malaria paras...
EDL45863     1193 EWLTFIQGLEGDWERLEVSLNKARERWMEQRNKEWAGWLRLIENKWSEYS-QISTKGKDPAGLRKREWSDEKWKKWFKAE 1271 malaria paras...
XP_002260974  248 DWNTFKQSLEADWGKFEMKLFKAKETWMEQKNKELSKWLSLVQNRWNKYC-EIPTTGEDPGNLRKQDWSSCEWIKWFNAK 326  Plasmodium kn...
XP_002257677  173 DWNAFKRSLEEDWEKLEVKLCESSKWLMQKKNNEWSNWIQLVKSKWSVHG-KVPNEEELDGSVVEPDWSYGTWGSCFKTQ 251  Plasmodium kn...
CAQ42671      269 DWNAFKKTFEEDWETLEVKLRESSKWLMQKKNNEWSNWIQLVKNKWSVHG-KVPNEEELDESVVEPDSSNGTWDSCFKTQ 347  Plasmodium kn...
CAQ41086      374 EWKKWMNNTENDWEKFMQSFERHKQMWIQEKENEWEEWLTNIHYNWLGFTTKLEGDYISDKTKYWKKWDENEWKGIIEME 453  Plasmodium kn...
Q8IK14        759 QWEDWKVYLEKQWSVWLEISENDKIEWLEDKEREFRSYIKYIYNIWFKWLKKRKGELTGE-QKPWMTWNEQEWETFFETR 837  Plasmodium fa...
EDL44604      613 QFKNWLNNLEKEYDAWKVSLVNDNNEWILKKNEIFENILNRIKEKWESWNIYTLKDINDDVIRLKDLDTEEQWSKWLDAQ 692  malaria paras...
XP_002262598  442 EWNKWMRHLEEQWHLFFKAQEIKTDDWIQKKEKEFKAWITEIETKWMNYNHNLDTEYNTDLYEKYPSWSENEWKTWIRTV 521  Plasmodium kn...
XP_001612666  180 VEAAMIADYKKWMRDAEENLQKWISKDLDIWKKKKFDEWLKVEWKKEEDAHWSKDSNTPygDtmNPLFSVLKKSYDMYTA 259  malaria paras...
XP_001612616  140 GKRIIENQWERWTISNKNLYYKIIMKEWFKWKNKKIKQWLKRNWLHHEGRILENWERLPy-T--KILAMSEKKPWFNSNA 216  malaria paras...
EDL45863     1272 VKSQIDSHLKKWMNDTHSNLFKILVKDMSQFENKKTKEWLMNHWKKNERG--YGSESFEvmTtsKLLNVAKSREWYRANP 1349 malaria paras...
XP_002260974  327 VKCPIHAQLEKWLDENHSNLFNILVKHMAQFKCKKIKGWLMYHWKMNEED--DDYETYAvmPtlKFLDLVQSRKWYHANP 404  Plasmodium kn...
XP_002257677  252 VYPRINSQLKNWLDDTHSNLFKFLVKGLVEVEDRKIKGWLMYHWKMNEED--DDYKTFGimPtaKFLNLAQSRQWYHDNP 329  Plasmodium kn...
CAQ42671      348 VYPTINAQLKNWFDDTYSYLFKLLLKGLVEIEDKKMKGWLMYHWKMNEED--DDYKTFGdmPtaKFLNLVQSQEWYLDNP 425  Plasmodium kn...
CAQ41086      454 WTRPMKVKWAKLVEKNEKIWGDKFFNYWDNWKDKKWNEWKNKNWKKKEEEQWNNFEEGKd--------lNNDENWKEWNE 525  Plasmodium kn...
Q8IK14        838 YKKQFLDEWYDMLKYMDKILNIRKYTLWNKWKGKKLTQWLMQDWKLIEDDEWEKYEEDKswS--KRFDMKKKNEWKKWRN 915  Plasmodium fa...
EDL44604      693 WKPYNKQTWFDLIDSYEKLYHQWKRTHWDKWKSRKMTEWISQEWKVDEEEKWAQWESQKw---eKYFQRKEKKE---WIE 766  malaria paras...
XP_002262598  522 GKKLMGKDWIQWINGHESKLNEWVQYDWFQWKSLKFFNWEINEWKSDEYEYWAEWQNGNl-G--MLLNKKKKKKYLSWKN 598  Plasmodium kn...
XP_001612666  260 RKKREKEHWNKLTENIGKTLTNK-KYVDWENMKMTKSGWYNEWMDFFLQQCLNSKVRK 316  malaria parasite P. vivax
XP_001612616  217 QVINERDYFLIWIKKKEDFLVNE-ERDKWENWEYYKNDFFQTWMDSFLSHWLNIKKRD 273  malaria parasite P. vivax
EDL45863     1350 NINRERRELMKWFLLKENEYLGQ-EWKKWTHWKKVKFFVFNSMCTTFSGKRLTKEEWN 1406 malaria parasite P. vivax
XP_002260974  405 NIDKQRKELMEWFLLKEKEYVKK-EQVDLSHWENIKHSSINSMITTFSEKRLTEKEWN 461  Plasmodium knowlesi strain H
XP_002257677  330 HIDKQRRELMLWFSHRENEYLGP-EWENWTYWKNEKINAVKLLCAELSRGCMAEGKWK 386  Plasmodium knowlesi strain H
CAQ42671      426 HIDKQRRELMLWFFHKINDYLGK-EWENWNYWKNEKMHEVKLLCEKFAKGCLNEEEWN 482  Plasmodium knowlesi strain H
CAQ41086      526 RLLREKQEWKNWVNEKEDSLMDA-EETHWKKWKEYKWNYLNEWMKQVKVKWLKAKPWE 582  Plasmodium knowlesi strain H
Q8IK14        916 RIFKEYIEWKEWIYYKGQSANVS-DVSYWEEWKEKKTNELKEWLDALTKQWMLQGKWK 972  Plasmodium falciparum 3D7
EDL44604      767 RNEIEISIIRDWLKEKESMPVQCdGWLEWDTWKQEKFQHLDDYLNSLKNQWLAEKKWM 824  malaria parasite P. vivax
XP_002262598  599 RIEREKSEWDSWTRSKELLLLKS-KTSNWMKWKNEKQLSFNDWIENFIETWISKKQWN 655  Plasmodium knowlesi strain H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap