Conserved Protein Domain Family
NPR1_like_C

?
pfam12313: NPR1_like_C 
NPR1/NIM1 like defense protein C terminal
This family of proteins is found in eukaryotes. Proteins in this family are typically between 251 and 588 amino acids in length. The family is found in association with pfam00023, pfam00651. There are two conserved sequence motifs: LENRV and DLN. NPR1 (NIM1) is a defense protein in many plant species.
Statistics
?
PSSM-Id: 372037
View PSSM: pfam12313
Aligned: 28 rows
Threshold Bit Score: 274.157
Threshold Setting Gi: 695076599
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFH44185     360 RRLTRPKDYHSKTSR-KEPSKDRLCIDILEREIRRNPLvSGDTPTC-SHSMPEDLQMRLLYLEKRVGLAQLFFPAEANVA 437 Arabidopsis lyr...
XP_009412232 365 KRLTRSTDYYRSTEQgEPSPRERLCIEMLEQAEMRDS--FMEVTSVpVEMISDNLQERLLYLESRVWLAESLFPTEAKAA 442 wild Malaysian ...
XP_006853864 359 KRLTKFIDFSRSTEEaEPTPKERLCIEILEQAERRDPL-PGEASVS-LAIAGDDLRRSLIYLETRVGLAKFLYPMEAQVA 436 Amborella trich...
XP_009408867 366 KRHTKSMEYFKSTEEgQASPKSRLCIEILEQAERRDPQ-VGEASAF-LAIAGDDLRGRLLYLENRVTLARLLFPMEARVA 443 wild Malaysian ...
XP_006645596 272 KRLTKHGDYFGVTEEgKPSPKDRLCIEILEQAERRDPQ-VGEASVS-LAMAGDSLRVRLLYLENRVALARIMFPMEARVA 349 malo sina
EES00131     372 KRLTNHGDYFGPTEDgKPSPKDRLCIEILEQAERRDPH-LGEASVS-LAIEGDSARGRLLYLENRVALARILFPMEARVA 449 sorghum
EMS58650     233 KRLTKHGDYFGNTEEgKPSPNDKLCIEILEQAERRDPQ-LGEASVS-LALAGDCLRGKLLYLENRVALARIMFPIEARVA 310 Triticum urartu
1_pfamImport   1 K---KHSDCFGVTEEgKLSPKNTLCIGILEQAERREPE-LGEASVS-LAMAGDCLHGKLLYLENRVALAMILFPAEARVA 75 
APY24056     358 KRLTRLVDFTKSTEEgKSAPKDRLCIEILEQAERRDPL-LGEASLS-LAMAGDDLRMKLLYLENRVGLAKLLFPMEAKVA 435 tomato
EEF48081     366 KQLTRAADYYKSTEEgKASPKERLCIEILEQAERRDPL-HVEASLS-LAMAGDDLRMKLLYLENRVGLAKLLFPMEAKVA 443 castor bean
EFH44185     438 MDVANVEGTSECTGLltPPPSNGTTGNLGKVDLNETPYVQTKRMLTRMEALMKTVETGRRYFPSCSEVLDKHMDeymdED 517 Arabidopsis lyr...
XP_009412232 443 MNNANVDGTLRFKSS--CLTNLISGNKRSAEDVVKASFKMTEKDFSRMEALTKTVQLGMHFFPRCSKVIDKFLG----DD 516 wild Malaysian ...
XP_006853864 437 MEIAQVEGTLELPLAa-ISKFTSREQMMTAVDLNDSPFKIKDEYLSRMKALSRTVELGKRFFPRCSAELNKIMNd---AD 512 Amborella trich...
XP_009408867 444 MDIARVDGTLEFTLGs-TT-SHSTGNQRTAADLNETPFTIKEEHLARMRALSRTVELGKRFFPRCSAVINKIMD----DD 517 wild Malaysian ...
XP_006645596 350 MDIAQVDGTLEFNLSs-GE-NPLPERKRTAVDLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMD-----D 422 malo sina
EES00131     450 MDIAQVDGTLEFTLGs-NA-NLPTEIQRT-VDLNDTPFIMKEEHLARMRALAKTVELGKRFFPRCSKVLDKIMD-----D 521 sorghum
EMS58650     311 MDIAQVDGTLEFTLGs-ST-NPPLEIT-T-VDLNDTSFKMKEEHLARMRALSKTVELGKRFFPRCSNVLDKIMD-----D 381 Triticum urartu
1_pfamImport  76 MEVAQVNGTSEFTLGs-SA-NPLTEIQRTTFDLNETPFKMKDVYLSRMRVLSKTVELGKRFFPRCSDVLEKMMD-----D 148
APY24056     436 MDIAQVDGTSELPLAs-MR-KKIADAQRTTVDLNEAPFKMKEEHLNRLRALSRTVELGKRFFPRCSEVLNKIMDa---DD 510 tomato
EEF48081     444 MDIAQVDGTYEFPLTn-IETKALSGAQRTTVDLNEAPFRIQEEHLNRMKALSRTVELGKRFFPRCSEVLNRIMDa---DD 519 castor bean
EFH44185     518 IPDMSHPEKGTVKERRQKRMRYNELKNDVKKAYSKDKEaKIARSCLSSSSP 568 Arabidopsis lyrata subsp. lyrata
XP_009412232 517 LSGLSIVEHINTEE---RKNRYNEILEEMNMAFTQDKN-EKAFGRSAASCS 563 wild Malaysian banana
XP_006853864 513 VWELAFLGKGTSEEQTKKRKRYVEVQEMLRMAFNKDKE-E-NKSAMSSCSS 561 Amborella trichopoda
XP_009408867 518 STDFAYLEHDASEE---KRMRFLELQDALSRAFSEDKE-EFNKSALSSSSS 564 wild Malaysian banana
XP_006645596 423 ETDPVSLGRDTSAE---KKRRFNDLQDVLRKAFHEDKE-AYDRSALSSSSS 469 malo sina
EES00131     522 ETELASLGRDTSTE---KKRRFHDLQDLVHKAFSEDKE-ENDRSAARSSSS 568 sorghum
EMS58650     382 EPELASLGRDASSE---RRRRFHDLQDALLKAFSEDKE-EFNKTTTLSSSS 428 Triticum urartu
1_pfamImport 149 EPGLAALGSDTTSE----MNRFHDLPDVLQKAFTAGKR----------KQQ 185
APY24056     511 LSEIAYMGNDTVEERQLKKQRYMELQEILSKAFTEDKE-EFAKTNMSSSCS 560 tomato
EEF48081     520 LSQLAYLGKDTVEERHQKKQRYMELQDLLSKAFNEDKQ-EFDKSNISSSSS 569 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap