Conserved Protein Domain Family
DUF3630

?
pfam12305: DUF3630 
Protein of unknown function (DUF3630)
This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. There is a single completely conserved residue D that may be functionally important.
Statistics
?
PSSM-Id: 403501
View PSSM: pfam12305
Aligned: 17 rows
Threshold Bit Score: 93.938
Threshold Setting Gi: 307633563
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5E8T0          5 SVIEFDKEVGRIIFAIpEFDFDT-FNGMGKQLVSAMDAKVIEQQVDADLHSWLIDFEGTHLMLRAEHYSNSVWLE-SLSS 82  Aliivibrio fis...
Q8EJX5          8 NAIQLDRSALSLSVSG-DIDFDH-FEAFAEPLAYALDCRLRERQWGADRHQWLLEFEGTPLWLNYEFYGNICWLS-VERE 84  Shewanella one...
Q12SJ7          5 TSVQLNQQALSLLIEA-DIDFDA-FEAFAEPLAQALDCQVRERQWGADRHQWLLDFEGSPLWLNYEFYGDICWLS-TQNE 81  Shewanella den...
Q088P5          4 LSAKLDPAALSIVIQA-EVDFEQ-FEQFAEPLAAALDCDIRERQWGADRHQWLLNFEGSPLWLHYEFYGDICWIS-TDSA 80  Shewanella fri...
jgi:Shew_0263   8 SAIKVEPQAKSLSILA-DVDFDR-FHPFAEALVKALDCRVIERHWGADRHQWLLEFEGSLLQLNYEFYGDVCWLS-VERD 84  Shewanella loi...
BAJ03936        4 ESLQLDPVAKSLSIQA-KIDFDQ-FDLFAEPLAAAMDARVIERHDGADRHQWLLTFEGTLIQLNYEFYAEICWLS-VEAE 80  Shewanella vio...
jgi:Sama_3323   4 YQVRLDKEAVSLAIRG-DIDVDR-FDDFAEPLAVALDCRVLERQWGADRHQWLLDFEGCRLWLNFEFYGDVAWLA-SDRE 80  Shewanella ama...
Q3IG61          2 TIIEYHHTHQCIIITPvEPPHDEdFELWSRLFLHHDEITINEYSAGADRHQLRFTYQQQTFNLNFEHYSQSIWIN----- 76  Pseudoalteromo...
jgi:Fbal_3669  13 grpQYSADRGQLLWPC-PLTQEQ-AAEVAPQLMARLECQLGALEQGADRLFWPARFEDTVLGLQFEALCDSLWLEaSDGA 90  Ferrimonas bal...
Q6LLQ0         13 MVRELDLAHGHLLLSGpNFDFDS-FPEIAEQLLVCIDARVIEKELNADLHVWIIDFEGSRLLLKGEHYASALWIE-ALSS 90  Photobacterium...
Q5E8T0         83 GEAlDELSFIVGL 95  Aliivibrio fischeri ES114
Q8EJX5         85 ADV-EVLEYLATL 96  Shewanella oneidensis
Q12SJ7         82 AEF-DVLQYLAGL 93  Shewanella denitrificans OS217
Q088P5         81 NEL-DVLAFLLTL 92  Shewanella frigidimarina NCIMB 400
jgi:Shew_0263  85 DEV-EVLVYLASL 96  Shewanella loihica PV-4
BAJ03936       81 DEV-EVLEYLASL 92  Shewanella violacea DSS12
jgi:Sama_3323  81 EDL-EVLEFLASL 92  Shewanella amazonensis SB2B
Q3IG61         77 GEGhDAEHLLAAL 89  Pseudoalteromonas haloplanktis TAC125
jgi:Fbal_3669  91 LDGaETLAFLAAq 103 Ferrimonas balearica DSM 9799
Q6LLQ0         91 ADN-DALAFIATL 102 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap