Conserved Protein Domain Family
DUF3623

?
pfam12291: DUF3623 
Protein of unknown function (DUF3623)
This family of proteins is found in bacteria. Proteins in this family are typically between 261 and 345 amino acids in length.
Statistics
?
PSSM-Id: 403491
View PSSM: pfam12291
Aligned: 25 rows
Threshold Bit Score: 191.751
Threshold Setting Gi: 500596078
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3J165                3 TSPWVVALSAIFVWWFSTGILLWRvrhaDNRGPEAHLTSVILGLPMLFAGAWGYVHTLHDETVGGVYVAFLSALGVWGWI 82  Rhodobac...
jgi:Bresu_3075        2 SVFVQPLLIAALVWWFSTGAILWL----VRLPRRTFGWSMGLYAVVAAAATVGVMIASRDQSALGAYVGFGCALAVWGWH 77  Brevundi...
WP_025293526          1 -msipPLFFALLMWFIGTATIVWL----DSRPRETFRTSLTLAGIAAIGAVVLVWVKADDASANAAYLGFAAAIVIWGWH 75  Sphingom...
rhodo:RCAP_rcc00656   2 NNPWLVALTTIFVWWFSTGAILWRirraDLSGRAAHMRSVVGGLPLLIGGYIAMANSADDTSVRGAHVAFLSAVSVWGWF 81  Rhodobac...
Q28W45                3 SSPWIAALVALFVWWFSTGAILFAvrraDQGGPHARLWACLMTLPFLVLGAAGFIDTLYNPTIAAVYVAFLSALALWGWI 82  Jannasch...
WP_025311373          3 SSPWIAGLVALFLWWFSTGVILLAvrraDREGAHARLWCVLMNLPFLVLGAAGFVDTLNDTSVAGAYVAFFAALALWGWV 82  Roseibac...
WP_012180201          3 SSPWIIALCAMFIWWFATGAILCIvkhaDRRGPRAHLRSVILTAPFGLLGVYGFSASLTEATVPGVWIAFASALLVWGWI 82  Dinorose...
Q16DT0                1 mSIWSASLLALFVWWFSTGAILWVvkvaDRRGGNAGTLATLWGLPMLALGIFGFWSTLDDMSAQGAVLAFLSALAIWGWI 80  Roseobac...
CAL75528              2 GATAIAIPYVVFVWWFSTGAVLALvglaARFPA-AFKW---GTAAAFVAALSGVAVSSQAAEDANAYCAFTCAILLWGTV 77  Bradyrhi...
Q6N9J6                2 VSYLGPPIFAAFVWWFSTGAVLLL----VGSVGRSELLRAVCAGGMLTIALCGLSVTAHDVSVGAAYMAFSCIIFLWGAQ 77  Rhodopse...
Q3J165               83 ELSFLSGVITGPNTDPCPLHARAPERFLRAVGTVLWHEIVLLTVLIAMAVHAAD--APNRFGLWTFLVLFVARVSAKLNL 160 Rhodobac...
jgi:Bresu_3075       78 EMGFLMGKLTGPRRTACPFGAQGWKRFTLSAETVIHHEIALALTAVLFVALTWD--QPNQTGTLTFLLLLGMRLSTKLNI 155 Brevundi...
WP_025293526         76 EMSFLMGAVAGPNRLECPPEATGWRRFTLATATVIHHELAIAATAILLFAVTWG--EPNQSAPLTFLLLFVLRVSAKFNL 153 Sphingom...
rhodo:RCAP_rcc00656  82 ELAFLSGVVAGPNRDHCPPFASMTERFLRSVGTLLWHEIGLISALILCAVLVWT--GENHFGLWTFATLFFARVSAKLNL 159 Rhodobac...
Q28W45               83 ELTFLTGTITGPVTSHSVPNVSEGERFIRAWGTVAYHEMLLAAVMVAMIILAWG--VENQFGMWTFAVLFAARISAKLNL 160 Jannasch...
WP_025311373         83 ELAFLTGVITGPVRVPMQEGLPEWERFIRAWGTIAYHEMLLAGLFIGMIVLSYG--AENQFGLWTFAVLFFARISAKLNL 160 Roseibac...
WP_012180201         83 EHAFLAGIITGPNSYDCPEGCSEFERFFRAWGTIAYHEMLLLTVLIVMGITAWG--ADNKFGFWTFSVLFIARISAKLNL 160 Dinorose...
Q16DT0               81 ELAFLTGVITGPNTYPLPPNTPEWERFIRAWGTLAYHEMLLVFTLISMFLVEWNmmAGNKFATWTFAVLFFARISAKLNL 160 Roseobac...
CAL75528             78 EMSLLAGWITGPRPEPCPRDCTPASRVGFALQAIAYHELALIATAGLVFAVTSG--APNRLSWWTFAALLVLRQSAKINL 155 Bradyrhi...
Q6N9J6               78 EIAFLSGWLTGPRAEPCPPGAKGFARFSYALQAIIYHEICLLACGGVVLVVTLG--AENQVGLWTYVALWVLRQSAKINL 155 Rhodopse...
Q3J165              161 YLGVPYINVEFLPSTLAHLSSYFRHTRMNRFFPLSVTLLTFATGCWIERALSAGGANHREVGFWLLAALTALAVLEHWFM 240 Rhodobac...
jgi:Bresu_3075      156 FLGVPNPPITFLPKGLSYLQSYFRRARFNALFPLSLGLSIVVTLLLGDAALS--TTGGAQTGYALMFMLAALGLLEHGFL 233 Brevundi...
WP_025293526        154 FLGVPNLSDEVFPEHLAYLKSYFRKARCNLLFPASILLGSGIAGWAWTAAVWAPAGSGAHASGMLLAGLAVLGVVEHLFL 233 Sphingom...
rhodo:RCAP_rcc00656 160 FLGVPRINTQFLPKPLAHLASHFRHARMNFLFPVSITVLTFATGCWMERAADA-QTDGIFIGFVLLTVLTALALLEHWFM 238 Rhodobac...
Q28W45              161 YLGVRKVNVEFIPEPLTHLPSHFGTARMNWLFPLSITGLSFAAACWLERLWTS-DTTADTVGFALLSALTALALLEHWFM 239 Jannasch...
WP_025311373        161 YLGVRKINVEFIPEPLNHLPSHFRTARMNWLFPISITGLSFAAACWLERIWAS-TGPADTVGFALLAALTVLALLEHWFM 239 Roseibac...
WP_012180201        161 FLGVRKINTEFLPTPLSHLPSHFRIRPINWLFPYSVTALTFAMTCWFERLYAA-ETAAATVGFTLLAVFTALALLEHWLM 239 Dinorose...
Q16DT0              161 FWGVPRINVDFLPNALAHLATYFRIRPLNWLFPISVSALTFAAACWLERMHGA-ETQGQIIGFALLSVITALALLEHWVM 239 Roseobac...
CAL75528            156 FLGVRTLNDELLPQQVRFMRSYFAKKSTNLLFPFSIAAATTATVLVAAAALGA-KSSFDGVALSLLASLIALGLLEHGFM 234 Bradyrhi...
Q6N9J6              156 FLGVPVTNDELMPDAVQFLKTYFARKPVSAFFPISVTMATAVLVVMIQRIVEVADTPFEVVGLTLVSTLFALGVVEHWFM 235 Rhodopse...
Q3J165              241 VVNLQDRKLWKWMMPERR 258 Rhodobacter sphaeroides 2.4.1
jgi:Bresu_3075      234 MLPSPDHALWGWALGRSE 251 Brevundimonas subvibrioides ATCC 15264
WP_025293526        234 VLPLRDAKMWRWASSSST 251 Sphingomonas sanxanigenens
rhodo:RCAP_rcc00656 239 VLPLPDQKLWTWMLPSVE 256 Rhodobacter capsulatus SB 1003
Q28W45              240 VLPLPDEKLWRWMLPARP 257 Jannaschia sp. CCS1
WP_025311373        240 VLPLPDEKLWRWMLPERP 257 Roseibacterium elongatum
WP_012180201        240 VVPLPDEKLWRWLMPAKD 257 Dinoroseobacter shibae
Q16DT0              240 VLPIPDEKLWRWMLPAPK 257 Roseobacter denitrificans OCh 114
CAL75528            235 ALPMPVINLWRWGAPVEP 252 Bradyrhizobium sp. ORS 278
Q6N9J6              236 LLPLPAITLWSWGIRPGF 253 Rhodopseudomonas palustris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap