Conserved Protein Domain Family
CsoS2_M

?
pfam12288: CsoS2_M 
Carboxysome shell peptide mid-region
This domain family is found in bacteria and eukaryotes, and is approximately 430 amino acids in length. This family is annotated frequently as a carboxysome shell peptide, however there is little publication to confirm this.
Statistics
?
PSSM-Id: 403489
View PSSM: pfam12288
Aligned: 10 rows
Threshold Bit Score: 486.576
Threshold Setting Gi: 123611179
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006460162   152 GRLVARTYRKAQS-EGKAal---kAKLSSSSSVSSIAK----MANPD----ANG----------------RQIAREVRHQ 203 Thiomicrospir...
jgi:Thimo_2949 169 GRAAALARRRAQSaRGKA------GVSAAGMSPAQTAR----AANPE----LSG----------------RELAKRLREQ 218 Thioflavicocc...
Q31HD7         148 GRLQSKAYRKAQA-KGKAgq--eaFKSNGSSQSGAKAK----LANPD----AST----------------REIAQQVRAE 200 Hydrogenovibr...
Q3SFK6          15 GREAALARRRALSiHGKSalqsgqAAKPRSATEARLAA----RATPP----ASTpaasaapaascgcqhgETFAARVEEA 86  Thiobacillus ...
tigr:AFE_1689  154 VRKLCQERRRALStQGKV-----------ASSCSRVSRishnSGQPDalagLSG----------------RDAAQARREA 206 Acidithiobaci...
CAK27724       176 SRSLVLARREAQSkRGKA------ATTSQSSGTAAVAR----QGNPD----MSS----------------RELALKVREL 225 Synechococcus...
WP_015107692   184 SRAIVMARREALSkRGKS------ASAPTSSVAASVAR----QSNPD----MSS----------------RELAQKVREL 233 Cyanobium gra...
CAK23106       175 SRALVLARREAMSkHGKT------A-GKQPTSAAAVAR----QANPD----LTS----------------RELAQQVREL 223 Synechococcus...
Q46GM9         187 SRAFVLARREALSkHGKS------A-GKQPTTAASVAR----QGNPD----LTT----------------KEIAQRVREL 235 Prochlorococc...
Q7V6G0         186 SRALVLARREAQSkHGKT------A-ANQPTSAASVAR----QGDPD----LSS----------------REISQRVREL 234 Prochlorococc...
WP_006460162   204 R---------------------CTQG-------KTss-gvCRPTG-----KVARKP-AASEPYPAKVGFSQTGYDQTVSG 248 Thiomicrospir...
jgi:Thimo_2949 219 R---------------------SHRGga---gqKR-----SAPSGrsravRTGASP-GAAQDAPWKVGASETSHGQTVTG 268 Thioflavicocc...
Q31HD7         201 R---------------------CAQG-------KTcstggSRP---------MRKR-RNAKEAPQKVGESQTLHGQSVSG 242 Hydrogenovibr...
Q3SFK6          87 RpaaapvapapisavrkrrieqSQKG-------RGda-ppCRPCG-----RVKPEP--------PKVQTGTTLAGSTVTG 145 Thiobacillus ...
tigr:AFE_1689  207 M---------------------CQKG-------RSdq-saYRPSG-----RTRQKP-----AAPAKVEQGTTLSGTSVTG 247 Acidithiobaci...
CAK27724       226 R---------------------SKSGaaskfggKAag-apTRPTGp---nRHGAKQ-AAAADAHWKVGASETLSGQTVTG 279 Synechococcus...
WP_015107692   234 K---------------------CKVGsa---gsSRsg--gSRPTGp---rRGQAKI-DAAADAHWKVGVSETVRGQVVTG 283 Cyanobium gra...
CAK23106       224 R---------------------AKAGar---nkQSag--vTRPTGp---nRHGAKQ-AAAADAHWKVGESTTSSGQTVTG 273 Synechococcus...
Q46GM9         236 K---------------------SKTGat---gsKRts--vTRPCGp---nKNGAKQnASVPDAHWKVGISETSTGQIVTG 286 Prochlorococc...
Q7V6G0         235 R---------------------SKSGat---gkKRsg--aCRPCGp---nRNGSKQ-AVAADAHWKVGLSETSTGQVVTG 284 Prochlorococc...
WP_006460162   249 TMVSD-TYKMTGSEAGSCRVISGTEYTSPDEFQAKCS-FKPea-nPRKVA---MTKTAAGRHVSG-TEVGLSEKVTGTEP 321 Thiomicrospir...
jgi:Thimo_2949 269 TLVGR-SHEVTGDEASTCRTVTGTEYLGTDIFRDFCQ-VEP----PKSVKrggVSPTRGGNRVTG-NEVGRSRKVTGDEP 341 Thioflavicocc...
Q31HD7         243 TQVGQgEKKMTGSESGACQLVSGTEYLGAEEFSKNCD-VQPtp-qPAKVT---QTQTTRGQVVSGsTKVGRSDKMTGNET 317 Hydrogenovibr...
Q3SFK6         146 NQVER-TTRVTGNESGTCRTVTGTEYVGAEQFGEFCG-TLPep-aPAKVG---QTSTSRGRRVTG-TEVGRSTRVTGDET 218 Thiobacillus ...
tigr:AFE_1689  248 TQVER-SAKVTGAEPGSCLAITGTEYIGTEQYGALCT-ATPep-aPAKVN---VGRTTRGQRVSG-VELGHSVKVTGDEH 320 Acidithiobaci...
CAK27724       280 TQANR-SPKTTGNEASTCRSITGTEYLGAEVFQAFCQ-GQPaaqqPAKVR---VTSTSRGNAVTG-NEVGRSEKVTGDEP 353 Synechococcus...
WP_015107692   284 TQANR-SLKTTGNEASTCRPVTGTEYLGAEIFRTFCQ-SDPtplqPAKVR---VSATSHGNRVTG-NEVGRSEKVTGDEP 357 Cyanobium gra...
CAK23106       274 TQANR-SVKTTGNEASTCRSITGTEYLGAEVFQTFCQ-QAPepttPAKVR---ITATSHGNRVTG-NEVGRSEKVTGDEP 347 Synechococcus...
Q46GM9         287 TQANR-SLKTTGNEASTCRSITGTQYLGSEVIDSFCNgSNTqisqPAKVA---VTSTSHGNLVTG-NEVGRSEKVTGDEP 361 Prochlorococc...
Q7V6G0         285 TQANR-SSKTTGNEASTCRSITGTQYLGSEVFDTFCQ-SAPqpgqPLKVA---VTNTSHGNRVTG-NEVGRSEKVTGDEP 358 Prochlorococc...
WP_006460162   322 GQCRGVTGTEYLPADQGEMFCGSKPESGPSK----VSQSRTAKNQIISGPSMLPREAMTGLEAGSERAITGTQYLshvak 397 Thiomicrospir...
jgi:Thimo_2949 342 GTCQSVTGTEYMGANLQEAFCGIKPENGPAE----FGSAAARGSQRATGREVGRSGRATGDETAAKRTLTGTQYM----- 412 Thioflavicocc...
Q31HD7         318 GTCSAITGTEYLPADQSKMYCGETPAKSKATgfsvMSQATQKSEQKVTGGDSRKSQSTTFKPKNPAs------------- 384 Hydrogenovibr...
Q3SFK6         219 GTCKRVTGTEYLAAEQAGEFCGTTPEPRPEK----AVMGMTAARNAVSGSDLARNVNVTGGEAGAARSITGSAYAd---g 291 Thiobacillus ...
tigr:AFE_1689  321 GTCKAVTGTEYLSADKFESFCATRPALTPAK----VSVAATEAGQRVSGTEVGRSARVTGDEPGSCRKLTGSQYYqpesf 396 Acidithiobaci...
CAK27724       354 GTCKAVTGTEYIGADQASAYCGGV-TPSVAK----VGRGVTAGGQAVSGVMVGRSEKVTGNESGSGLQLTGDQYI----- 423 Synechococcus...
WP_015107692   358 GTCKNVTGTEYISANQSTAWCGTT-TPSPRK----VGLTRTSAGRPVSGVIVERSERVTGNEPGAHRQLTGTQYV----- 427 Cyanobium gra...
CAK23106       348 GTCKNVTGTEYISANQSAAYCGSG-VTSPRK----VGHSLTEQGRPVSGVMVGRSASVTGDEAGSGRSLTGDQYL----- 417 Synechococcus...
Q46GM9         362 GTCKNLTGTEYISANQSNNYCGGV-NPSPSK----IGYSQTIDGQKVSGTMTGRSALVTGNEAGSNKGLTGDQYL----- 431 Prochlorococc...
Q7V6G0         359 GTCKTLTGTEYISANQANQYCGVS-QPSPRK----VGQSVTEDGRKVSGVMVGRSEKVTGDEAGSNRQLTGDQYL----- 428 Prochlorococc...
WP_006460162   398 LAKEPSRqarpgimsVPTKVDVSETSAGNRVSGTNVNFYKPVTGDEAGFCKTVSGNEYQSREARSARCGDTLQPAAKKVA 477 Thiomicrospir...
jgi:Thimo_2949 413 PIDQPEA--------VPPKVGHSATSSGGTVTGTLVGRHKAMTGDEAGSCRNVTGDDYIGLEQFIEFCDATPPRTERKIG 484 Thioflavicocc...
Q31HD7         385 ---------------APHKVMPSQTAKGNTTTGSQVGRLESVTGGERGSCHAVTGTGYQGAEEAKA-CDMPMTETADKVT 448 Hydrogenovibr...
Q3SFK6         292 SARSTTEg------rGPKKVETRRTGAGATVSGTLPGRSSKLSGDEPGACARVTGSDYVNTEEFVSFCRTEPYQSPAKVG 365 Thiobacillus ...
tigr:AFE_1689  397 GSLCRDGg------sAPHKVSVMSTLREHALTGTETAPGNRVTGTERGVCASVTGTESAGLAQYQA-CNRKPVPTPEKVG 469 Acidithiobaci...
CAK27724       424 GSEAPIAg------rGPTKVTSLNTLRGTGVTGTAVGRASRMTGNEAGSCRAITGDEYIGSQQYEGFCGTRPPAEAPKVG 497 Synechococcus...
WP_015107692   428 GDQSQVPg------rAPAKVSSLHTLRGTGITGTHVGRSEHVTGDEPGSCRLVTGDEYIGTQQYEQFCGTKPAPEAPKVG 501 Cyanobium gra...
CAK23106       418 GSDPLPDg------rPAAKVGLSGTLSGTGVTGTMVGRSAQVTGDEFGSCHRVTGDQYISAEQVNAFCGGKPEPEAAKVG 491 Synechococcus...
Q46GM9         432 GSDPLPSg------rPAEKVGSLTTIRGNGVTGTDVSRRENVTGNEAGSCKNVTGDEYVGAGQFDSFCGSKPAPDPAKVG 505 Prochlorococc...
Q7V6G0         429 GVDPLPEg------rSAEKVGSFNTLRGAGVTGTNVARSEYVTGNEPGSCKRVTGDEYVGPQQYNTFCGGKPNPEAAKVG 502 Prochlorococc...
WP_006460162   478 ESKTFAGHKITGDRAGLGGKITGAGAGRCKSVTGSSYQSLDAV-EECDLP-IERVKPDYMNRPGFAAKPTTGTQPGPMG- 554 Thiomicrospir...
jgi:Thimo_2949 485 VSATLGGERITGTMTGRAPRVTGDEPGTCKAITGTPYAGAEQYqAYCESTqAGQAVVRMQPDKRTFGAVMTGIQPAVDGr 564 Thioflavicocc...
Q31HD7         449 ASGTAGGQKVTGDRSGAYYGMTGAEAGDCKTITGTSYTGTEQF-QFCSVDeQNEMKVRQRKGAN---PSISGVQPGPQG- 523 Hydrogenovibr...
Q3SFK6         366 VSRTFAGQDVSGTQVGRAARVTGDEHGTCKPVTGTSYIGAEQYaEFCAARtAAEAINRARLSRN---ADLTGIQPGPDAk 442 Thiobacillus ...
tigr:AFE_1689  470 VTHTWHEQPVSGTSVERSPKVTGDEYGGCQPVTGTEYAGPDQYaAFCASDhQATAQALMAKQSGVADAMMTGIRLGPDNk 549 Acidithiobaci...
CAK27724       498 FSITNRNQVVSGTRTGRSAMVTGDEPGSCKAVTGTPYAGLEQSgEFCGARaVDSVRERTPVRNS---NRMTGIQPGIGGa 574 Synechococcus...
WP_015107692   502 FSVTNKALVVSGTRTGRSEKVTGDEPGTCKAVTGTPYAGMEQAgTWCSSDrLSEIRQRTPVRMG---TVMTGIQPGIGGv 578 Cyanobium gra...
CAK23106       492 FSITNRNQVVSGTRTGRSERVTGDEPGSCQAVTGTPYAGLEQAgQHCGTPaVQAIRERTPVRPGTPSAAMTGIQPGVGGv 571 Synechococcus...
Q46GM9         506 LSITNKTQSVSGTMTGRSHLVTGDEPGTCKAVTGTPYAGLDQAnQWCDNSaSSEVEARTPRKTGTPGARLTGQQPGIGGk 585 Prochlorococc...
Q7V6G0         503 LSLTNKSQTVSGTLTGRSELVTGDEPGTCKAVTGTPYSGVEQAsGWCDTNsVREIQDRTPKLLGTPGAVMTGLQPGVGGv 582 Prochlorococc...
WP_006460162   555 LTGAQQGVCSSVSGTPYQGIDQTSAMC 581 Thiomicrospira aerophila
jgi:Thimo_2949 565 TTGDAKGACEPVTGTPYVGADQAMAVC 591 Thioflavicoccus mobilis 8321
Q31HD7         524 LTGAQKGACELVTGSHYQGGDQTAMVC 550 Hydrogenovibrio crunogenus XCL-2
Q3SFK6         443 MTGNERGTCQPVSGTPYLGEGQAAAVC 469 Thiobacillus denitrificans ATCC 25259
tigr:AFE_1689  550 VTGSARGEGQVLSGTPYAGTDQRAlhk 576 Acidithiobacillus ferrooxidans ATCC 23270
CAK27724       575 MTGAERGACEDVTGTPYVGADQQAANC 601 Synechococcus sp. RCC307
WP_015107692   579 MTGAERGACEDITGTPYIGGDQMAEAC 605 Cyanobium gracile
CAK23106       572 MTGDEKGACEAITGTPYVGADQLATAC 598 Synechococcus sp. WH 7803
Q46GM9         586 MTGAHKGACEPLTGTPYVGGDQLADNC 612 Prochlorococcus marinus str. NATL2A
Q7V6G0         583 MTGAEKGACEPLTGTPYVGGDQLVQAC 609 Prochlorococcus marinus str. MIT 9313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap