Conserved Protein Domain Family
Waikav_capsid_1

?
pfam12264: Waikav_capsid_1 
Waikavirus capsid protein 1
The rice tungro spherical waikavirus polyprotein is cleaved into 7 proteins, including three capsid proteins, by the tungro spherical virus-type peptidase pfam12381. This family represents the capsid protein 1.
Statistics
?
PSSM-Id: 152699
View PSSM: pfam12264
Aligned: 3 rows
Threshold Bit Score: 338.084
Threshold Setting Gi: 81973681
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O11979  708 EQAFQDEEKRTVDPniSDMYNAIKSEYLVKSFSWKVSDGQDKVLSNINIPEDLWNTNSRLNDIMSYFQYYKATGLTFRIS 787  Maize chlorotic dwa...
Q9J0S9   10 QEAHQDSSVAAAGP--IDEHNAMLQKIYLGSFKWKVSDGGGSILKTFSLPSDIWAANDRMKNFLSYFQYYTCEGMTFTLT 87   Rice tungro spheric...
Q6EEL1  697 TETFRDNESRVTDPnrSDMFAAVTAEYLVKSFTWKVSDGQDKVLADLDLPQDLWKSNSRLSDIMGYFQYYDATGITFRIT 776  Maize chlorotic dwa...
O11979  788 TTCIPMHGGTLFAAWDACGCATRQGIATAVQLTGLPGIMIEAHSSSLTTFSVEDPLTQSTVCLSGSEHSFGRIGILKICC 867  Maize chlorotic dwa...
Q9J0S9   88 ITSIGLHGGTLLVAWDALSSATRRGIVSMIQLSNLPSMTLHASGSSIGTLTVTSPAIQHQICTSGSEGSIANLGSLVISV 167  Rice tungro spheric...
Q6EEL1  777 TTCVPMHGGTLCAAWDANGCATRQGIATTVQLTGLPKTFIEAHSSSETIIVVKNSNIQSAICLSGSEHSFGRMGILKICC 856  Maize chlorotic dwa...
O11979  868 LNVLNAPQAATQSVSVNVWVKFDGVKFHFYSLKKQPV 904  Maize chlorotic dwarf virus
Q9J0S9  168 ANVLCADSASAQELNVNAWVQFDKPKLSYWTAQHTIA 204  Rice tungro spherical virus
Q6EEL1  857 LNTLNAPKEATQQVAVNVWIKFDGVKFHVYSLRKNPV 893  Maize chlorotic dwarf virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap