Conserved Protein Domain Family
zf-SNAP50_C

?
pfam12251: zf-SNAP50_C 
snRNA-activating protein of 50kDa MW C terminal
This domain family is found in eukaryotes, and is typically between 196 and 207 amino acids in length. There is a conserved CEH sequence motif. SNAP50 is part of the snRNA-activating protein complex which activates RNA polymerases II and III. There is a cysteine-histidine cluster which contains two possible zinc finger motifs.
Statistics
?
PSSM-Id: 403463
View PSSM: pfam12251
Aligned: 65 rows
Threshold Bit Score: 170.469
Threshold Setting Gi: 126117465
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN19067                      202 HEYLVLGRQRVTELRDKIHCFMDe--------------LmckEELHDPSGYFLIEDVFCKDMRDPS-----AIDYSEPIF 262 Amborella trichopoda...
Q8IKM4                        440 AEYEILSNQTLANLTDVFFCFDTsn----------------yGLPKCDGSLYFIDGILYPDLRSNN-----AVDYSTSIL 498 Plasmodium falciparum 3D7...
EDO08621                      305 REFDMLSSQTLAELRDAFRCASEi--------------RplnVDLKANGSCFMLNGQLFPDLRND------ACDYSEPLL 364 Babesia bovis...
XP_002141266                  212 AEFDVLEYQTLAEIRDAFNCDDSk-------------rEeelLKVKTKGACFFIDGVLYPDLRETEd---gIINYATYLK 275 Cryptosporidium muris RN66...
EAZ51565                      249 SEFDILETQTLSELSNSFICHDSk-------------qEeelLGFHPTGDCFEINGDLY--LNGTDd---iKSNFINTLS 310 Cryptosporidium parvum Iowa II...
WGS:AAGF:cds.TTHERM_00317010A 209 NEYLVYDIQFLQDLVFKIECLSEklserip-----sgqqsqpDSKFMKPSFLFIENTFYNNQY--------KIDVKNLYH 275 Tetrahymena thermophila SB210...
XP_003722863                  221 EVWAVLSCQPLVALLDAIDCPTAr-----------------dPLTTSRNAFFFIHGVFYIDDRHRSht--dFVDLSEVIR 281 Leishmania major strain Friedlin...
Q38E05                        235 ETWAVLSCQSLGTLLDTFVCRNCi------------------PVNISKNAFFFIGGTFYVDNRHAGeggedYEDLTAPIR 296 Trypanosoma brucei...
Q4D342                        234 DSWAVLSCQTLGALLDAFECRNCl------------------PVNMSKNAFIFIGGTFYVDNRHAGiegenYDDLTAPIR 295 Trypanosoma cruzi...
XP_003244583                  165 kTLQFYDTQTLHDLKQGFKCENEeseisgdisknphkpLefiVNSDLKHGLFYINNNLYVDSLPDRs----TLMHAETMK 240 pea aphid...
ERN19067                      263 D--WMRNNkddalqkwssilskglkkfkaflpdstlATSLPSFK--------AVDMHNTLFCDLKFRLGAGYLYCHQGDC 332 Amborella trichopoda...
Q8IKM4                        499 N--FYKMKkmktnfik---------------------------------ypykinqDKAILSQIEIPLFKKCCFLHQGTC 543 Plasmodium falciparum 3D7...
EDO08621                      365 H--FLYNYk---------------------------PGILRTSE--------CIEQTDAVLSHLELPIYMPGFLLHHGDC 407 Babesia bovis...
XP_002141266                  276 G--YCNTVniig------------------------------------nkeeIIPMHKRKLNEISIPINLPCSFLHSGDC 317 Cryptosporidium muris RN66...
EAZ51565                      311 G--FTMKSnp-----------------------------------------qIFDMKNTQISHLNIPINSHSTYIHSGDC 347 Cryptosporidium parvum Iowa II...
WGS:AAGF:cds.TTHERM_00317010A 276 E--WQQEAkins--------------------qnsgMQFEEEFE--------EKTLNEM-FEQIKIQIGKPYVFRHQNKC 324 Tetrahymena thermophila SB210...
XP_003722863                  282 RndPLQDV-----------------------------SSFHALEhqgfarcpVKSAAETTFKDLNIKMGESCLLRHCGGC 332 Leishmania major strain Friedlin...
Q38E05                        297 HfdPCGEGa--------------------------sTEGETRQKniafgncpVKYVSQTTFGDLNLRLGEYGVMRHLGWC 350 Trypanosoma brucei...
Q4D342                        296 YfqPLKDV------------------------------DPGNTQnlafgrcpVKYMSETTFADLDVRLGEFGVIRHIGWC 345 Trypanosoma cruzi...
XP_003244583                  241 S--WASCNght--------------------------------------iqnILSM-DTQLLDLEVCIGQPYVYQHLGRC 279 pea aphid...
ERN19067                      333 KHTMVIRDM-RLFH-PEDVQNKAAYPLLVFEHQTFDHKCSICGIFRAVKVTYD-DKWAPTNPSYFCENCYYLLHYSKDGS 409 Amborella trichopoda...
Q8IKM4                        544 EHRIVFNNI-RQYNkLRD-KHLSKYPLRTFKPNISNKYCISCHKNIAQKIVLD-SYLLKENPSYMCNNCFDLFLMDKNNQ 620 Plasmodium falciparum 3D7...
EDO08621                      408 EHRLMITAI-RIFDrTRDCPYEECYPLKVFMPRQRAKQCNVCEYNEPSTTVFN-SLVLPHIPSHLCNYCYTRLKLLESSG 485 Babesia bovis...
XP_002141266                  318 EHRFTFTNI-RVYQeCIDCPYEDVYPLQIYSPSTILTFCEICGINLANKLIFN-ALNLPKNPSYLCDSCTFAFLYDKETK 395 Cryptosporidium muris RN66...
EAZ51565                      348 EHRVTFTNI-RLFNsKYDSPYKDSYPIQIYSHSRTLTFCEICGINQVTKVIFN-SLNLPRNPSQLCDSCTFIFLYDKNTK 425 Cryptosporidium parvum Iowa II...
WGS:AAGF:cds.TTHERM_00317010A 325 DHMIVFNEI-RLWN-TDLPADKDLYPFNVFLPKVKRRKCDGCNLFFTEIVCFN-DKVSSKNPIFLCEKCFNQTHINWKKE 401 Tetrahymena thermophila SB210...
XP_003722863                  333 DHYFFLSHArSLSGyPRK--ERHEFPHRVAKVRDQARRCLLCRLFPATVALYE-DPLSPESPAFYCAVCFDLLHSSDTPE 409 Leishmania major strain Friedlin...
Q38E05                        351 NHYFYLSSVtSLRGfDRDDHTRAAYPQRVMKTPTRVVRCRLCRSHPATVVCYN-DEISPESPCPYCVPCFELLHATDEGE 429 Trypanosoma brucei...
Q4D342                        346 THYFYLSSVqSLRGmKRYHYEKGAYPQRVMKAPTRVVRCRMCRQFAATIACYN-DELSPNSPCPYCVPCFELLHATDEGV 424 Trypanosoma cruzi...
XP_003244583                  280 EHLFIFNEI-NIAK-SNDCLGQTNYPRVISVAKEKLKNCIFCYKNIASIVMLNdDERTPLTVNHMCESCFKSYNYDHLDD 357 pea aphid...
ERN19067                      410 LLy-----NDFTVYD 419 Amborella trichopoda
Q8IKM4                        621 PId-----TSMKYFD 630 Plasmodium falciparum 3D7
EDO08621                      486 GVyrsdglASSVAIE 500 Babesia bovis
XP_002141266                  396 --------NPLENFI 402 Cryptosporidium muris RN66
EAZ51565                      426 --------QSIEKCI 432 Cryptosporidium parvum Iowa II
WGS:AAGF:cds.TTHERM_00317010A 402 LRy-----NDFSYYP 411 Tetrahymena thermophila SB210
XP_003722863                  410 EA------AQYQRRE 418 Leishmania major strain Friedlin
Q38E05                        430 VEe-----GKFFAIR 439 Trypanosoma brucei
Q4D342                        425 VEe-----EKFIAIK 434 Trypanosoma cruzi
XP_003244583                  358 KV------SDFKAYR 366 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap