Conserved Protein Domain Family
AftA_N

?
pfam12250: AftA_N 
Arabinofuranosyltransferase N terminal
This domain family is found in bacteria, and is typically between 430 and 441 amino acids in length. This family is the N terminal region of AftA. The enzyme catalyzes the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. The N terminal region has been predicted to span 11 transmembrane regions.
Statistics
?
PSSM-Id: 403462
View PSSM: pfam12250
Aligned: 31 rows
Threshold Bit Score: 441.689
Threshold Setting Gi: 133914881
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014011350            47 QVIGAGVLAALMTLAAWIVLARTHLPAFSNSNVTKALASAGAILVLAVLGLVIYRMLHPRKQgtkgtkgtkgtetprwks 126 Coryn...
P9WN03                  31 QLAAAVVVAVGVAVVSLLAIARVEWPAFPSSNQLHALTTVGQVGCLAGLVGIGWLWRHGRFR------------------ 92  Mycob...
Q9CDA6                  10 QIVLAAVVASGVAAVSLIAIARVHWPAFPSSNQLHALTTVGQVGCLTGLLAVGGVWQAGRFR------------------ 71  Mycob...
WP_019510919            10 QMLAAAATATALAVIALLAIARVEWPAYNSSNQLHALTTVGQFFCLAGVFAAGVLWRRGR-R------------------ 70  Mycob...
A0R611                   8 QMVLAVLMASAVAGVAIAAIARVEWPAYNTSNQLHALTTVGQFGCLAGLFAAGLLWRRGR-R------------------ 68  Mycol...
jgi:Mvan_5629           16 QMLVATVVAVAVATVSLVAIARVEWPAYNSSNQLHALTTVGQVACLIGLLASGLAWRRGR-T------------------ 76  Mycol...
WP_014210374            10 QMAVAVIIAVTVTAVSLVAIARVEWPAYNSSNQLHALTTVGQFVCLAGLFACGLLWRRGR-R------------------ 70  Mycol...
UANL:O3I_000795         35 EALLAAVVATVVTGVGLLAFSRVQWPAFNSSNVTRALTTVGQVVAAVLLIAAIALLRRQRWP------------------ 96  Nocar...
PRJNA231235:Y013_17535   2 QFVCAALVAALVAAVGLFAFDRVQWPAFNSSNVTQAVTTVMQFAALAVLGLSIYLLRRRRWV------------------ 63  Rhodo...
WP_005516292             1 -MILGAFVAAIVAAVGLFAFGRVSWPAFPSSNVTQAVTTVGQVVTIAVLALCVALFRARRWT------------------ 61  Rhodo...
WP_014011350           127 ILSTLVCWLAPAALVIALIGIPLAATRLYLGGISVDQAFRTQFLTRMTEDPGFGDMAYPDMPSFYPRLWFLTGGMFAKLA 206 Coryn...
P9WN03                  93 RLARLGGLVLVSAFTVVTLGMPLGATKLYLFGISVDQQFRTEYLTRLTDTAALRDMTYIGLPPFYPPGWFWIGGRAAALT 172 Mycob...
Q9CDA6                  72 RLAQLGGLVFVSAFTVVTLGMPLGATKLYLFGISVDQQFRTEYLTRLTDSAALQDMTYLGLPPFYPPGWFWIGGRVAALT 151 Mycob...
WP_019510919            71 LLARIASVVFLSAFSVVTLAMPLGATRLYLFGISVDQQFRTEYLTRLADSPALHDMTYIGLPPYYPAGWFWLGGRLADLT 150 Mycob...
A0R611                  69 TLARLGALAFISAFSVVTLAMPLGATKLYLFGVSVDQQFRTEYLTRLTDTAGLHDMTYIGLPPFYPAGWFWLGGRIAAAT 148 Mycol...
jgi:Mvan_5629           77 VLARLGAPVFLSAFAVVTLAMPLGATKLYLFGISVDQQFRTEYMTRFADQPGLHDMTYIGLPPFYPPGWFWIGGRLAALT 156 Mycol...
WP_014210374            71 VIARIGTALFLSAFSVVTLAMPLGATKLYLFGISVDQQFRTEYLTRFADSPALHDMTYYGLPPFYPPGWFWIGGRMAALS 150 Mycol...
UANL:O3I_000795         97 WAAKVLSWVGVSTFVTFTLGMPLAATKLYLFGVSVDQEFRTEYLTRLTDTAALRDMTYADLPPFYPAGWFWIGGRVANVL 176 Nocar...
PRJNA231235:Y013_17535  64 TGARVLSWAALSGLVTATLGMPLAATRLYLHGISVDQEFRTQFLTRLTDSAALRDMNYADLPSFYPAGWFWIGGRVANLL 143 Rhodo...
WP_005516292            62 RAATLLSWAGLSGFVTVTLGMPLSATKLYLHGVSVDQEFRTEYLTRLTDSAALHDMTYADLPPYYPAGWFWIGGRVANLL 141 Rhodo...
WP_014011350           207 GLSGWAAFQPWALITLAVAASVLVPVWHRITGSlPLAAIIASATTVTLLYVAPEEPYGAVVALGMPAAAAIAGRAMRG-- 284 Coryn...
P9WN03                 173 GTPAWEMFKPWAITSMAIAVAVALVLWWRMIRF-EYALLVTVATAAVMLAYSSPEPYAAMITVLLPPMLVLTWSGLGArd 251 Mycob...
Q9CDA6                 152 GTPAWEIFKPWAITSITIAVAITLVLWWQMIRF-EYALLVTIATAAVTLVYSSPEPYAAMITVLLPPALVLTWSGLRAae 230 Mycob...
WP_019510919           151 GMPAWEMFKPWAIISITAAIAVALVLWTAMVRF-ETALAVTTATAAVTLAYTSSEPYAAVITVLLPPVFVLAWSGLKGtn 229 Mycob...
A0R611                 149 GTPAWEMFKPWSIVSITIAVALALVLWAAMIRF-EYALVATAASTAAMLAYASTEPYAAIITVLMPPVFVLAWAGLRArt 227 Mycol...
jgi:Mvan_5629          157 GTPAWEMFKPWSVVSIAVAIVLAYALWAAMIRF-EYALVVSTATAAATLAYSPAEPYAAIIAVLLPPVFVLAWSGLKGrt 235 Mycol...
WP_014210374           151 GTPAWEMFKPWAIISITVAVVLAFVLWAAMIRF-EYALIVSTVTTAATLAYSPAEPYAAVITVLLPPVFVLAWSGLRGgk 229 Mycol...
UANL:O3I_000795        177 GLTGWEAFKPYAIGSLAVAAVISLVLWSKLIRA-DWAVAVTAAVTALAVAYAAPEAYSAVIVILLPPALVLAWGALHRpl 255 Nocar...
PRJNA231235:Y013_17535 144 GMDGWEAFKPYAIGSLAVAAVVALVLWSELVRS-DVAVLAATATTLVVLAYGSPEPYGAVIAVLVAPALVLAWGGFLPat 222 Rhodo...
WP_005516292           142 GMDGWETFKPYAIGSIAVAAVVALVLWTKLIRT-DRAIVVALATAALTVAYASSEPYGAVIAVLIPPVLVLAWGGLHRpd 220 Rhodo...
WP_014011350           285 -----------SRAAIAGLIIYLGLSANLYTLYTGISAASVTLVALVIAWQawrgrrtdagTSPW--------------P 339 Coryn...
P9WN03                 252 ---------rqGWAAVVGAGVFLGFAATWYTLLVAYGAFTVVLMALLLAGSrlqsg------------------ikaavD 304 Mycob...
Q9CDA6                 231 readrtlgnkrGWATVVGAGIFLGFAATWYTLLLAYTAFTVVLMTLLLATAlcrrag-----------------fratfD 293 Mycob...
WP_019510919           230 ------------rgALVGAGVFLGVAALFYTLLLAYAAFTITLMALVLAVAgr------------------------riA 273 Mycob...
A0R611                 228 r--------ggGWAAIVGVGIFLGVAALFYTLLLVYAAFTLTIMALCVAVArr------------------------hiD 275 Mycol...
jgi:Mvan_5629          236 rpgepgirrsgGWAAIVGTGIFLGVTGLFYTLLLAYAAFTLTVMAVLLAAArr------------------------hwD 291 Mycol...
WP_014210374           230 sygveggrtraGWAAVIATGVFLGVAALFYSLLLGYAAFTLTIMALVVAIArr------------------------sfG 285 Mycol...
UANL:O3I_000795        256 dag----ktlgGWGAVLGTGLFLGWSATFYTLYAAFAAFAVALMGLIAAGLavreqraathPRRArgaaetrppwraavP 331 Nocar...
PRJNA231235:Y013_17535 223 rgg----rgrqGWGAVVGTGLFLGLAATFYTLYLGIAAFAVTVMAVVAAYLarratg----------------swravlP 282 Rhodo...
WP_005516292           221 rt------grgGWGAVVGTGIFLGVAAAFYTLYLGLSAFAITLMALVAAGLavraqg----------------swrgavA 278 Rhodo...
WP_014011350           340 PLLRLVTVGVGSGIIALIGWGPYFYALLTS-SHGSTGRAQHYLPEIGTELPTPFFEFSVVGALSLVCIVWMVLNFR-DRT 417 Coryn...
P9WN03                 305 PLCRLAVVGAIAAAIGSTTWLPYLLRAARD-PVSDTGSAQHYLPADGAALTFPMLQFSLLGAICLLGTLWLVMRARsSAP 383 Mycob...
Q9CDA6                 294 PLRRLAGIVVIAAAIGAITWLPFLARAAHD-PVSDTGSAQHYLPADGAELAFPMLQFSLLGMICMLGTLWLIVRTSsSVR 372 Mycob...
WP_019510919           274 PLLRLLVVAGISGALALLTWAPYLLAALRG-APADTGTARHYLPMDGAELTFPMLDFTLLGALCMLGTIWLVVHARrSST 352 Mycob...
A0R611                 276 PLLRLAVIAVISGAIALLTWAPYLLAAMRG-EPADSGTAQHYLPDAGAELHFPMFSLTLHGALCMLGTVWLVVRARtSTR 354 Mycol...
jgi:Mvan_5629          292 PLLRLLTIAVISGLIALIGWGPYLLAAARG-TPAETGTAQHYLPRDGAELSFPMLQFTLLGALCLLGTAWLVIYARsSTR 370 Mycol...
WP_014210374           286 PLLRLLVIAAISGAMWLIGLGPWLLAASKG-TPAESGTAQHYLPEAGANLEFPMLRFTLLGALCMLGTLWLVWRARsSTR 364 Mycol...
UANL:O3I_000795        332 PLVRLAVIAVLAALVALIVWLPYLLKTLSG-KVATSGSAFHYLPESGAELPLPMAEFSLRGALCLIGLLWLVVRAAsSRR 410 Nocar...
PRJNA231235:Y013_17535 283 VLVRLVVMASIAVLVALIVWAPFVFDVLGGnPPSESGTATHYLPDAGARLPLPMFHMSLIGLLSLLGTVWLVGRASsSHR 362 Rhodo...
WP_005516292           279 PLVRLAVIAAIAIAIALTVWLPYLLEALHG-VPAGSGTATHYLPDAGARLPLPMLQLSLSGALCLLGTIWLVFRVTsSRR 357 Rhodo...
WP_014011350           418 VQCLLSGLVVAYAWVVLSMIMPLRGTTLLGFRMELPISLFLVTGGVLALEQLrrsgvAKAYPALVTPQRAPQVTAVLGIL 497 Coryn...
P9WN03                 384 AGALAIGVLAVYLWSLLSMLATLARTTLLSFRLQPTLSVLLVAAGAFGFVEA-----VQALGKR-----GRGVIPMAAAI 453 Mycob...
Q9CDA6                 373 ASALMISVLAVYLWSLLSILTTLARTTLLSFRLQPTLTVLLVTAGVFGFIET-----AQSLAKH-----NRAVLSVASAI 442 Mycob...
WP_019510919           353 AGPLAVGVLAVYAWSLLSMLYTLLGTTLLSFRLQPTLSVLLAAAGTFGFVWL-----TQAAVARYQHP-GRHVVAVAATI 426 Mycob...
A0R611                 355 AGALAVAVVAVYAWSLLSMLTTLAGTTLLSFRLQPTLTVLLTTAGAFGFIEA-----TLAIAHRYRPETSRRVVAAATAV 429 Mycol...
jgi:Mvan_5629          371 AGALAVAVLAVYAWSLLSMVTTLVGTTLLSFRLQPTLTILLAAAGAFGFIEV-----TRAAAARVRPANAPKVVAVATAV 445 Mycol...
WP_014210374           365 AGALTVAVLAVYAWSLLSMLTTLVGTTLLSFRLQPTLTVLLAAAGAFGFIEV-----ALAVAHRYQPETRRRVVALAAAL 439 Mycol...
UANL:O3I_000795        411 AQALGIGVLAVYLWTLLSMAATAAGTTLLSFRLESVLLALLAAAGAFGFVEG-----ARAIYQALNE--PRQFRIAVVAV 483 Nocar...
PRJNA231235:Y013_17535 363 AQALGLGVIAVYLWYLASMALTAVGNTLLAFRLEVILLVLLAAAGAFAFVDF-----SRWISLATSE--NPRVRRVLVAV 435 Rhodo...
WP_005516292           358 AQALGIGVVAIYLWSLMSMAFTAVGGTLLSFRLEPVLILLLGAAGVFGFFDF-----ARWLVLATSE--NPRVKASVVVI 430 Rhodo...
WP_014011350           498 LV 499 Corynebacterium variabile
P9WN03                 454 GL 455 Mycobacterium tuberculosis H37Rv
Q9CDA6                 443 GL 444 Mycobacterium leprae TN
WP_019510919           427 GL 428 Mycobacteriaceae
A0R611                 430 GA 431 Mycolicibacterium smegmatis MC2 155
jgi:Mvan_5629          446 GV 447 Mycolicibacterium vanbaalenii PYR-1
WP_014210374           440 GT 441 Mycolicibacterium rhodesiae
UANL:O3I_000795        484 AV 485 Nocardia brasiliensis ATCC 700358
PRJNA231235:Y013_17535 436 GA 437 Rhodococcus pyridinivorans SB3094
WP_005516292           431 GL 432 Rhodococcus hoagii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap