Conserved Protein Domain Family
AftA_C

?
pfam12249: AftA_C 
Arabinofuranosyltransferase A C terminal
This domain family is found in bacteria, and is typically between 179 and 190 amino acids in length. This family is the C terminal region of AftA. The enzyme catalyzes the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. The C terminal region is predicted to be directed towards the periplasm.
Statistics
?
PSSM-Id: 403461
View PSSM: pfam12249
Aligned: 35 rows
Threshold Bit Score: 247.165
Threshold Setting Gi: 502904723
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA235944:CFAL_00610 495 IPSLNERHIDLAYTDSDGNANRGDRFPADSTAYYATIDKVLFDKLGTR-AGAIILTDEKNFMAYYPYHGYQAITAHYANP 573 Coryn...
PRJNA209048:CARG_00305 469 IPNRISHAIEMAYTDTDGYGERGDKNAPDSATYYATIDKTLKDWGYEP-GETVVLTDEQNFMSYYPYRGFQAFTSHYANP 547 Coryn...
Q8NTW4                 481 LPQKNARAIDLAYTDTDGYGERADLYPAGAARYYKDINDHLLDQGFEP-SETVVLTDELDFMSYYPYRGYQAFTSHYANP 559 Coryn...
Q8FU59                 507 IPERNAHAIDLAYTDTDGYGERADLYPPDSARWYREIDSHLQDQGFIP-SETIVLTDELNFMSYHPYRGFQAFTSHYANP 585 Coryn...
CeBiTec:A605_01275     522 IPVRNENGIDHAYSDTDGYGERADRFAPDVAQYYDEIDAEIRSHGHEP-DDTVVLTDETNFMSYYPYYGFQAFTSHYANP 600 Coryn...
WP_005287422           487 IPAENESFIDEAYASTDGNGERSDLRESDVGRYYKQMDEYIQSRGYTP-GETVLFTDEINFMAYHPYRGFNAFTSHYANP 565 Coryn...
WP_010188306           469 IPATNVTALDHAYTDTDGYGERADRYTSDSSANYGQIREFIDAQGYEA-NDTVVLTDEKLFMAYNPYYGFNAFTSNYANP 547 Coryn...
CeBiTec:B841_01080     477 IPTRNEDAIDHAYTDTDGYGERADRFPPDAASHYEDVVEEISSHGHEP-TDTVVLTDENRFLAFYPYYGFNAFTSHYANP 555 Coryn...
CeBiTec:B843_00725     492 IPNQNADEIEMAYSETDGNGERADKFPADSTQYYPAINDEILSHGFVP-RDTVVLTSEKDFLSYYPYRGFQAFTSHYANP 570 Coryn...
Q6NK77                 508 IPDRNAHAIELAYTNTDGDGHRADFLPPDATQYYAEVDRVIQEKTGKPaADTVVLTDEFNFLTYYPYLGFQAFTSHYANP 587 Coryn...
PRJNA235944:CFAL_00610 574 LGEFAKRNDEIE-----TWTKitdPAKLTAAMDKAQethgWQAPDALILRGQLDVEGEIdksgslmpkdgslptvkgtgd 648 Coryn...
PRJNA209048:CARG_00305 548 LGEFDKRNDAVEhlastSWTA---PKNFNRSIDDLP----WRAPDVFIFRGQTNDTSST--------------------- 599 Coryn...
Q8NTW4                 560 LGEFGNRNAFIEdlairSWDEladPQQFSDALNTSP----WTIPEVFIFRGSIDDPDAG--------------------- 614 Coryn...
Q8FU59                 586 LGEFGKRNEAIEqwaveSWNElsdPADFAAAIDAVE----WAGPDVFIMRGTVPEDADAegggdt----------apggv 651 Coryn...
CeBiTec:A605_01275     601 LGEFGRRNAAIEawasgSWDElsePADFAAALEDAP----WREPDVFIFRGSLDGNGGEe-------------------- 656 Coryn...
WP_005287422           566 LGEFDARNESLKqwangSFNElsnPQAFAAAIDDAP----WAPPQAFIFRGSETDPEAP--------------------- 620 Coryn...
WP_010188306           548 LGEFSTRNLQIEewaskSWEQt--PEEFAKSLESAP----WRGPDVLIFRGDLEEPGDG--------------------- 600 Coryn...
CeBiTec:B841_01080     556 LGTFNARNDVILewglqSWDEledPADFAAALDEAP----WRAPDVFLFRGELDEIDEDdp------------------- 612 Coryn...
CeBiTec:B843_00725     571 LGEFDQRNAKLDewasrSWDDladPEKFAQALDESP----WKSPQVFIFRGQSDDAESG--------------------- 625 Coryn...
Q6NK77                 588 LGEFEKRNAVIEnwasqSWDSlkdPQDFDRAVSNVP----WRSPDAFVLRADSTGSSDSk-------------------- 643 Coryn...
PRJNA235944:CFAL_00610 649 gEFSYMIADDIYPNQPNVRFRTVKFKAKAFAEg---WDLNQVGPYVVAI 694 Corynebacterium falsenii DSM 44353
PRJNA209048:CARG_00305 600 -GWKYDLAEDIYPNNPNVRFRGIYFNPQAFQG----WRTQQVGPFVVAS 643 Corynebacterium argentoratense DSM 4...
Q8NTW4                 615 --WKYDVAEDLYPNNPNVRFRGVYFNPESFDQm---WQTKQVGPFVVVT 658 Corynebacterium glutamicum ATCC 13032
Q8FU59                 652 gGWKYDLAEDIYPNNPNVRFRGVYFNPEVFLGagapWEVEQIGPFVVVT 700 Corynebacterium efficiens
CeBiTec:A605_01275     657 -GWKTHIAEDIFPNNPNVRFRGLFFNPEVFTGdpsmWHASQIGPFVVVS 704 Corynebacterium halotolerans YIM 700...
WP_005287422           621 --WKTHIAHDIFPSQPNVHYEALFFNPAAFNSp--eWDTQQFGPFVVVV 665 Corynebacterium genitalium
WP_010188306           601 --YKTHLAEDIYPNQPNVRYRAVFFNPEVFEEg---WNTQQIGPFVVAA 644 Corynebacterium aurimucosum
CeBiTec:B841_01080     613 eGWKTHLARDLFPNQPNVRYDALFFNPASFADes-lWATAQIGPFVVVT 660 Corynebacterium maris DSM 45190
CeBiTec:B843_00725     626 --WNFDVAEDIYPNNPNVRFRGVKFNPAAFQSd--hFEIKEIGPFVVVT 670 Corynebacterium vitaeruminis DSM 20294
Q6NK77                 644 dGWNFNLAIDIFPSNPNVWFKGVRFNPEVFQGenspWTVTQVGPFVVVT 692 Corynebacterium diphtheriae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap