Conserved Protein Domain Family
PRP21_like_P

?
pfam12230: PRP21_like_P 
Pre-mRNA splicing factor PRP21 like protein
This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with pfam01805. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form.
Statistics
?
PSSM-Id: 403444
View PSSM: pfam12230
Aligned: 13 rows
Threshold Bit Score: 142.959
Threshold Setting Gi: 74860368
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDO49841           216 DIHDPHKVLDRVKYRVEWVKHQEKEKQKLEDEREKERVAFASVDWHDFVVVETVEFKD-DETGNLPPP-VTQEQLGARI- 292 starlet s...
Q5KPZ5             238 DPDWKWHILDEARNRAEWEKTRRKRENERAKEEEEEAKAFAAIDWQDFVTVETIEFTQnDEQLELPPP-TSVEKLKSMS- 315 Cryptococ...
Q22RL3             216 NGKSKQHIYSQALRIFDHLKQKRQQEKKQSEIEKEERLLKESIDWNDFYVAETIDFNDsF---------ANYNNSNTLT- 285 Tetrahyme...
Q5CYJ0             209 ESEDLQAIFRRCYKNSLWRKKEVETNSGLLELENRDHV---DLEWVAINIVETVDFD--DLNLDLPEP-VDFSMLSKLV- 281 Cryptospo...
EDK38476           177 SLSPDYSIISDAYKRAFHRKQNRMRSRNEKVAQQERQTRFASIDWQDFSLVGKLEFDViDEVSELPPP-LTRNEVIYRS- 254 Meyerozym...
Q6BXH7             184 RLSHPDDIFESAYRRAHYNKQHKAELQNEKKVEEQKKLAYTSIDWQDFAIVGQIEFDAvDEVRELAIP-LRREDLIYRS- 261 Debaryomy...
EAZ63914           189 QLNDADKMISNAYKRAQYDKMNKVERKEKQKLIEQKQAHFASIDWQDFAIVGMIEFDAiDEVKELPAP-LSRENLLYRS- 266 Scheffers...
EDO18556           173 KYSTKRDIIERCFKRAEFYEYSKEIESKKDEIKKLQDIQFAAFDWTNFKTLATIDFN--IENDTFVKP-IDLNSLKIKQ- 248 Vanderwal...
Q6FUL7             178 HIDLKQIVLDRCFRRAEYAEYTKKLQDVKHKIAHERKIHFAAIKWTEFKVIASM-----AKLHREPKPaIKFNELIIST- 251 [Candida]...
Q6CDU9             186 AVKDKFYALGLAKRRAEWISHTEQKNQRAIEEAERERIAFAEIDWHDFVVAETIVFSDkDKTGELPAP-LTLAQLQFSS- 263 Yarrowia ...
O13900             214 NVRDPYSLLSKIQPRVRWQSHMESQKKKQKEEAEKEKLEYAQIDWNDFVVVEVIQFTKsDEHAKLAKP-TNLADLQTAT- 291 Schizosac...
WGS:AAAA:OsI_06527 266 GAKDLTTVLERCLNRLEWDRSQEQARQQAEDEIEQERMQMQMIDWHDFVVVETIEFAD-DECEGLPVP-LTLEELKRRKr 343 long-grai...
Q86A14             250 YFSNKQTILERAMNRCEYNQLKEIEEQKKEEREDEEKTIIASIDWHDFVIVDTIEFNE-DDLDDLPQP-RTFDQLIAG-- 325 Dictyoste...
EDO49841           293 ---LAQERYEKvqd--------agpTEEDFNMDVEMEVDETNKDNQSKDMEmdmdddgpppaPPSepairLPPlpptgag 361 starlet s...
Q5KPZ5             316 ---MAEKRMAAmvmeet--gagptgETAPPAEEMEMEEDEEEEEARLQRIK-----------AEQeqaraREVqraameq 379 Cryptococ...
Q22RL3             286 ---QAQDIPAI--------------PEIPAVQPTPIEEEKPKEPPKKDIPTvpgpneiqpsiIPD--------------- 333 Tetrahyme...
Q5CYJ0             282 ---LESSLDML--------------NENDRNDLLESEIQNEERQINVLVIEkeqi----ndnVSDelnntNNDdafeeef 340 Cryptospo...
EDK38476           255 ---LETRQDDV---------------LSSRKRPAENDLDEKEKETSTDKAAak--------------------------i 290 Meyerozym...
Q6BXH7             262 ---LESKQKEL--------------DLAKAKAQPKYESQDTTPERSETEVAkhp------------------------kp 300 Debaryomy...
EAZ63914           267 ---LESKSKDL-------------------ELPAPAPVSTAKTDEDKVKVAtvsk----ppaI----------------- 303 Scheffers...
EDO18556           249 ---LTNKNKVI----------------TSIFTDVEIINIEKNEESTKRSEGkk-------------------------sk 284 Vanderwal...
Q6FUL7             252 ---IDGKNSAL--------------SVFDTATGKEIPLLEQREEASAEKKTn---------------------------k 287 [Candida]...
Q6CDU9             264 ---LEQRSRGLkleyapnsddddeeENKEIVTKGKMEVKEDAKEEAKEDAKegst----evvVKEepkvySAP------- 329 Yarrowia ...
O13900             292 ---LEQKSAMF----------------TMPDQNYTIEEAPPTAEPWEPISApkkq----efgVSLppslaSPEkggisst 348 Schizosac...
WGS:AAAA:OsI_06527 344 iedLGEEEAAM--------------ELAEPVKDVEMEMDEEEIQLVEEGMR-------------------AARleenegg 390 long-grai...
Q86A14             326 ----DTPFGGSdfdndghgsngkggQDMEMEMDMEMEMDDEDNNNNEDEIEessl----sstNTTgnlppKDQ------- 390 Dictyoste...
EDO49841           362 SNLQIRRDYDPKAAKPQAPPLPPek---------ylISPITGERVPAEAMAEHMKINLLDPR-WKEQRDKAi------MD 425 starlet s...
Q5KPZ5             380 RGMKIKKDYVPRGIQRTNAVATA-------------ICPNCGQSIPENELTEHMRIELLDPK-WKEQKKQL-------EL 438 Cryptococ...
Q22RL3             334 ENIKIKADYKRQQNNQRNECT---------------KCQICGQLIPIDDYNQHLEIEMLDPK-YQQLKKE--------QQ 389 Tetrahyme...
Q5CYJ0             341 KNIKIIKNYVRVPKKRGLVTKSEqkkk-----gkmyRCPITGQLIPDEEISNHMRILLLDPK-WKQQKDQL-------VQ 407 Cryptospo...
EDK38476           291 PGMKIKAAGESRLRKHQKTEPTI-------------KCPISGIMVPESQFDSHLKSLLRDPR-YQEQQDNY-------IK 349 Meyerozym...
Q6BXH7             301 KGMKIRAAGESRLKNKSKPNNSAasdm-----aghiKCPITGKFIPELQFDNHLKVLLRDPR-YKEQQDNF-------VR 367 Debaryomy...
EAZ63914           304 KGMKIRAAGESRLKKSEVSTTSGvep--------siKCPITGKMIPESKFDNHLKVLLRDPR-YKQEQENF-------VR 367 Scheffers...
EDO18556           285 RKMKIKAAGETRLKKQKQTQGQAqnk-------kmiECPITKKMIPEDSFEQHMQTLLGDPR-YREQKLKY--------- 347 Vanderwal...
Q6FUL7             288 KKMKIRAAGETRLNKRKASEAPSddhpaekkgkrmvRCPITNNLIEEDKFDQHIRTILNDPTiYAEEKKKY--------- 358 [Candida]...
Q6CDU9             330 SNMKIRPAGTSKLNKLKNSSPAT-------------VVTPSGEVVPESSYDSHMRVYTLDPN-WKAQKD---------LA 386 Yarrowia ...
O13900             349 TSVSPAAQASPVLSTTTQPKVQKpvpkafqpkvpmeISPFSGELVPATELEEHMRLKLLDPR-WQEQRK---------VE 418 Schizosac...
WGS:AAAA:OsI_06527 391 VQVKLAGDEEPPMRIVKNYKRPEeripaerdptkfvVSPITGELIPISEMEEHMRISLIDPK-YKEQKER--------ML 461 long-grai...
Q86A14             391 SKLKIVKDYQKSNSSVKSNAPTKlt----------qLCQFCKQEIPLDEMQEHMRIELI----QKQQRDSRlggggssNN 456 Dictyoste...
EDO49841           426 KKQQEEVFAEGIAIGSSLKQLAER 449 starlet sea anemone
Q5KPZ5             439 RRAQAQQLQQGADVVSSLKNLASA 462 Cryptococcus neoformans
Q22RL3             390 ASSKTSSTVHDPQIIQNLYDMKKH 413 Tetrahymena thermophila SB210
Q5CYJ0             408 RAQQESALTASSNIEENLIAFITK 431 Cryptosporidium parvum
EDK38476           350 KNFKYASNLTTDQVYDNIKRIAKR 373 Meyerozyma guilliermondii ATCC 6260
Q6BXH7             368 KNFTYSSNLTTDEVYDNIKRLARK 391 Debaryomyces hansenii
EAZ63914           368 KNFSYASNLTTDQVYENIKRIVRK 391 Scheffersomyces stipitis CBS 6054
EDO18556           348 DAERKITNLTSHDVYRNVKNVSKK 371 Vanderwaltozyma polyspora DSM 70294
Q6FUL7             359 KQSHSLSNLTSDEVYQNIKRLVKR 382 [Candida] glabrata
Q6CDU9             387 DSRAQSTNLATSGVTHNMKRMAEA 410 Yarrowia lipolytica
O13900             419 ESRKSTLNLENVNVAANMKRLVSQ 442 Schizosaccharomyces pombe 972h-
WGS:AAAA:OsI_06527 462 AKIKETTLAPDDEISRNIVGLART 485 long-grained rice
Q86A14             457 NNNLTNTLTQDDDIARNLQSFASK 480 Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap