Conserved Protein Domain Family
DUF3603

?
pfam12227: DUF3603 
Protein of unknown function (DUF3603)
This protein is found in bacteria and eukaryotes. Proteins in this family are about 250 amino acids in length.
Statistics
?
PSSM-Id: 371975
View PSSM: pfam12227
Aligned: 15 rows
Threshold Bit Score: 338.522
Threshold Setting Gi: 384073157
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A8FBY4          35 LLDQVPLLKVQSPLYDYIENDLSELPKTLLESVFEKSYIRKNHERRKLEYCFVVTDGIRIIAVDTIGYSIPVRKSRLIPR 114 Bacillus pumi...
Q65LC6          35 LLDQVPLLRVSSVLFHYIENDLSELPAELLNEVHQKAYIRKNHERTQLDHCFVVTDGIGILAVDTAGYTIPVRKSRLIPR 114 Bacillus lich...
Q8ERU3          34 LLDQVPLLYISKELLHYIENDMHDLPKSLLDTIYKRGYTRKGQKRTVVEYAAVVTDGDNILAFDTVGYYIPIRKSRLIPR 113 Oceanobacillu...
CCG44648        35 LVDQIPLLLVTNELFNFIENDLQDLPLPLLQDVHRKTYMKKNQERQTVEYAAVLTDGEDVIVFDTLGYTLPVKKSRLIPR 114 Halobacillus ...
Q81TS7          35 LLDQVPLLKVDSTLYHYIENELLELPQKLLEDVHHKAYIRKNHERLQQEYCFVVTDGKGIIAIDTIGYNVPIRKSRLIPR 114 Bacillus anth...
Q5L1T7          35 LLDQVPLLKVSPALFHYIENSLSDLPKPLLDDVHQKAYVRKNHERIQLDYCFVVTDGAGVLAVDTIGYQIPIRKSRLIPR 114 Geobacillus k...
jgi:Bcell_2913  35 LLDQVVVIKMQSNLFDYIENTLQELPEELLADVYKQSYVRRKSQRVELEYCFIATDGVRSIVVDTIGYHTPVRKSRLVPR 114 Bacillus cell...
Q9K8Y0          35 VLDQVVVVRVSPPLFDYIENQMSDLPEDLLQDVYQKSYLRKNMSRIQLDYAFVASDGERIIAVDTMGYKTPIRKSRLTPR 114 Bacillus halo...
ADC48467        35 VLDQAILIKVSQELYDYIENHLSDLPEDLLEAVHQQSYLRKNMSRIQLDYCFIATDGAGIIAVDTMGYKTPIRKSRLTPR 114 Bacillus pseu...
Q5WEY9          35 VLDQVKLLKVDEKLMDYIEDQLLDLPMELLKEVFQKSYLRKNMSRIQLDYCFIATDGKRIIAVDTMGYKTPIRKSRLTPR 114 Bacillus clau...
A8FBY4         115 QEQLVYEMVKDVKAEEYEFSQDSLEssKEYHILSLPPQHISGLTRKERQLKQLMFMALDQLKGLQNRAEIAYWYTEWNPR 194 Bacillus pumi...
Q65LC6         115 QEQLVYEMVKDVEAETYEFAPEKLQssKEYHILSLSPEHVRGLTRKERQLKQLLFMALDQLKGLQNRAEIAYWYTEWNPY 194 Bacillus lich...
Q8ERU3         114 QEQLVYDMIENNKPQNFEFDNKIHD--KEYHMLSMPPEYVFGLTRKERQLKQLLMIGLDQLRTTNNKEELRYWLTEWDPK 191 Oceanobacillu...
CCG44648       115 QERLVFEMVQGKKPASYSIEESVL---KEHHILSLAPAKMAGLTRRERQLKQLLMMALDQLKNSDHPEEIRYWLTEWDPD 191 Halobacillus ...
Q81TS7         115 QEQMVYEMVENVQAEKYEFQVEEME--KEHHILSPSPFVMNGLTRKERQLKQLLFMALDQLHTTKNTAEIRYWFTEWDPS 192 Bacillus anth...
Q5L1T7         115 QEQLVYEMAAEAEERDYPLPRYE----KEYHILSPAPELMCGLTRKERQLKQLLFMALDQLYSTKNTAQMRYWYTEWAPE 190 Geobacillus k...
jgi:Bcell_2913 115 QEEQLLTLVESELQREFYMDYLDCE--KQYHILSPEPSLMKGLIRKERQLKQILFMALDQLYNDAEEAELKYWYTEWAPH 192 Bacillus cell...
Q9K8Y0         115 QEQLVYELLQNESDICYDLQGHEPK--KEHHILSPDPMEMKGLTRKERQLKQLLYMALDQLFTSGNEAEIRYWLTEWEPD 192 Bacillus halo...
ADC48467       115 QDQIVYEMLEQNQFETFELKEKHEP--KEYHILSPDPDDMRGLTRKERQLKQLLYMALDQLYHSGNDAEVRYWYTEWNPR 192 Bacillus pseu...
Q5WEY9         115 QEQVVFETLTEQDVPYFQLEIPLPA--KDYHLLSPSPAELAGLTRKERQLKQLLLMVLDQLQTTGSDAEIKYWCTEWDPL 192 Bacillus clau...
A8FBY4         195 MYNQIKRMSFEEIWNMLYNETIDGWSENHLAFCEKMIKGQPFFEKLWEMENESKVN 250 Bacillus pumilus SAFR-032
Q65LC6         195 MYEQIKRMTFEEIWDMLFNETIDGWSDKHRDFCENLIKGQPFFEKLWEIENESKVN 250 Bacillus licheniformis DSM 13 = ATCC ...
Q8ERU3         192 QYPSIRYMDEEQVWTALYDGVKHGWSSAHEDLCSKLIRGQAFLERMWEAEMGNE-Q 246 Oceanobacillus iheyensis HTE831
CCG44648       192 QYPYLKQLTNEEAWDLLYEGTCKGWTSLHEELCEKLVKGQPFFETIWQGENQHvsh 247 Halobacillus halophilus DSM 2266
Q81TS7         193 AYGMVQHMEFEDIWAKLYDEAKTGWSEKHEQLCERLVKGQPFFEKLWEMENEQKVN 248 Bacillus anthracis
Q5L1T7         191 KYAAIQKMSFDEAWEQLYNETKYGWSERHEQLCENLIKGQPFFEKLWEMEQEPKVN 246 Geobacillus kaustophilus HTA426
jgi:Bcell_2913 193 KYREIQEMSYEEAWSCLYEDIKYGWSEKHEDYCFTMIKGQPFFEKLWELQQGEiek 248 Bacillus cellulosilyticus DSM 2522
Q9K8Y0         193 RYDEIQGMDHHQAWETLYRDVRQGWSEHHYHFCESLIKGQAFFEKLWELEHGESVK 248 Bacillus halodurans C-125
ADC48467       193 DYVRIQMMTRDEAWHELYNEVKAGWSKQHHHLCEAMVKGQAFFEKLWELEHGESVK 248 Bacillus pseudofirmus OF4
Q5WEY9         193 TYKKLQQKGRTEVWEQLLNGVRAGWSQRHYKLCEAMVKGHSFFEKLWELEHPERVK 248 Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap