Conserved Protein Domain Family
MTHFR_C

?
pfam12225: MTHFR_C 
Methylene-tetrahydrofolate reductase C terminal
This family is found in bacteria and archaea, and is approximately 100 amino acids in length. There is a conserved NGPCGG sequence motif. This family is the C terminal of methylene-tetrahydrofolate reductase. This protein reduces FAD using the reducing equivalents from reduced FAD, subsequently reduces tetrahydrofolate. The C terminal of MTHFR contains the FAD binding site and is the catalytic portion of the enzyme.
Statistics
?
PSSM-Id: 403442
View PSSM: pfam12225
Aligned: 92 rows
Threshold Bit Score: 98.0069
Threshold Setting Gi: 501125351
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015404604    390 TYTLVEHLIKKILFHCRMCGDCTLAESSYLCPQSGCPKKMINGPCGGSN-NGYCEVYPnKRLCFWVRSYHRGLEPDCHTI 468 Desulfocapsa...
jgi:DaAHT2_2428 400 ALIHFEHLLKFLAFGCKNCGDCTLVELAYLCPQAACAKYILNGPCGGSR-DGWCEVYPgRRRCIYVRAYQRLKSVGRQAE 478 Desulfurivib...
jgi:Psed_2105    58 AFTTVERVTKQELFGCRMCGQCALPATGYTCPMT-CPKQLRNGPCGGVSaSGGCEVHP-ELPCVWVVAYERSEQAGHGAD 135 Pseudonocard...
WP_014433252     39 AIKPVEDFAKERLFGCRHCGQCILHSTGMSCPME-CPKNLRNGPCGGVRaDGHCEVKP-AMRCVWVVAYENSLQMPIYGH 116 Caldilinea a...
BAL27049         44 PVAAFERSVKGFLFDCKMCGQCALSSTGMSCSMN-CPKNLRNGPCGGVRaNGHCEVRP-DMKCVWVEAFAGSRRMHITGQ 121 Azoarcus sp....
Q92K71           79 PVTFVERHVKGFLFDCRMCGQCALSSTGMSCPMN-CPKQLRNGPCGGVRaNGNCEVEP-DMPCVWVQAWKGSQNM-VKGD 155 Sinorhizobiu...
WP_013332108     44 PVARLERAIKGLLFDCQMCGHCVLSSTGMSCPMN-CPKRLRNGPCGGVReDGGCEVKP-EMRCVWLDAWEGSQRM-KHGD 120 Halomonas el...
Q88E30          377 VLHTLERSVKRPLVGCDTCGRCRLEDTLYICPET-CPKGLANGPCGGTA-LNRCEFG--DRECIHSVKYRTAKAVRQTAV 452 Pseudomonas ...
Q6FBE2          366 ILLKIEHSSKHRLVGCESCGECRLGDTLYICPET-CPKGLANGPCGGTS-LDRCEFE--DRECIHSVKARLAKKIHQTEI 441 Acinetobacte...
WP_012583983    110 LKIEPGRSLGSFARLCSACGECWIYYTGNLCMEKLCPKKMRNGPCGGSE-EGMCEVF--NRLCPWVILFKN-KRITEEEF 185 Dictyoglomus...
WP_015404604    469 HsPKPIPPKDWS 480 Desulfocapsa sulfexigens
jgi:DaAHT2_2428 479 MkDDLVPPRDWS 490 Desulfurivibrio alkaliphilus AHT 2
jgi:Psed_2105   136 L-DLLQRPVDQR 146 Pseudonocardia dioxanivorans CB1190
WP_014433252    117 EmHQIQPPVNRQ 128 Caldilinea aerophila
BAL27049        122 QiHVVQKPVDRR 133 Azoarcus sp. KH32C
Q92K71          156 AiMNVQKPVNQS 167 Sinorhizobium meliloti
WP_013332108    121 RiHVVQLPVDAS 132 Halomonas elongata
Q88E30          453 LtERLIPCIEVE 464 Pseudomonas putida KT2440
Q6FBE2          442 LkTKLIPAISit 453 Acinetobacter baylyi
WP_012583983    186 L--KIIPPKDFS 195 Dictyoglomus turgidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap