3FWC


Conserved Protein Domain Family
SAC3

?
pfam12209: SAC3 
Click on image for an interactive view with Cn3D
Leucine permease transcriptional regulator helical domain
This domain family is found in eukaryotes, and is approximately 80 amino acids in length. The family is found in association with pfam03399. This domain is a helical domain in the middle of leucine permease transcriptional regulator.
Statistics
?
PSSM-Id: 371963
View PSSM: pfam12209
Aligned: 27 rows
Threshold Bit Score: 73.4082
Threshold Setting Gi: 754409456
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FWC_F          7 TEQIANDLVKEVVNSSVISIVKREFSEAN---YRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFE 80   baker's yeast
XP_001528228  891 VEATLQKIVTDCIDNELRNLLPNIFQDYNaktQRVNMIKSLGSQLFDAFMSEIIYNQSQECLADQFCNSLTKKHVLH 967  Lodderomyces elo...
CCE43440      774 ADQIAHELISNMVDSEFRAILENVLHRHNtkvQRLKIIMTLEEELFSAFVAESAYQCTLETASQYMSNLLAQKHAIr 850  Candida parapsil...
XP_007374915  762 ARETMNDIVRNCVDAELVNVITQCMRAHAiqtERARVIEKLSDDLYEAFLSEVIYETAAEAKADGYYQRCLTKRVIH 838  Spathaspora pass...
EER34522      797 LDQIYQTIFQRTVSSELQVVLSRIFNDFHaanERKRIINLLGEELYDAFFSDIVYELTYEAKAYQFYVLNLKKRCLR 873  Candida tropical...
EMG51051      755 LQQVFHDILQDTMDSELKLILSRILEDFYtenERKGVITSLSGELYDAFLTEVIHEVVYEAKAYQFYVTNLKRKSIK 831  Candida maltosa ...
XP_001384284  746 VKQIFDSILQGTIDHELSALLPQLIKRQNrhqEHKQIIGSLSEELYDAFISEIVYQTTLESRAVEFYNHNLKLRYIE 822  Scheffersomyces ...
XP_002770301  819 LNEVYFEILQNTINSELHRLLPKLIRAENscqERTKVIKSLSNELYQAFMSEIIYKTTLEVKADSFQRTSLKLKTIK 895  Debaryomyces han...
XP_006689701  751 TKHIMNSIVSQTVTEELNKYLPKLIRHQNqqrERSRVINSLSKELYEAFLNEIVFKMATEVKAEAFFIKNIKITYIK 827  Yamadazyma tenui...
XP_004196607  795 ldSVYKQILSYQVNKELGKLLQNVLDYQAsnvRRRDVIRKIGTEVFSDLLSNVIFDTTSSTYAESFYERNLKLRMIK 871  Pichia farinosa ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap